DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and Gzmm

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:238 Identity:78/238 - (32%)
Similarity:120/238 - (50%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQ--TRFFVV 113
            ||:||: :|.|   .|:|.||::..::||:||||: :.|.:||.:..|..||:..:.  ..|::.
  Rat    39 PYMVSL-QNTK---SHVCGGVLVHQKWVLTAAHCL-SEPLQQLKLVFGLHSLHDPQDPGLTFYIK 98

  Fly   114 ERRWHPQFRVLGGNDIAVLRI--------------YPKFPLDDVRFRSINFAGKPQRDSGTQASL 164
            :...||.:.:...||:|:|::              .|:.|.|           ||.  .|::.|.
  Rat    99 QAIKHPGYNLKYENDLALLKLDGRVKPSKNVKPLALPRKPRD-----------KPA--EGSRCST 150

  Fly   165 VGWGRVGV-GKIRK-LQEMPFLTMENDECQQSHRF--VFLKPLDICAMHLK-GPRG--PCDGDSG 222
            .|||.... |::.| |||:....::...|..| ||  ..|....:|   || |.:|  ||.||||
  Rat   151 AGWGITHQRGQLAKSLQELDLRLLDTRMCNNS-RFWNGVLTDSMLC---LKAGAKGQAPCKGDSG 211

  Fly   223 APLMNVAKEKLYGLLSYGRKACTPL-KPYAFTRINAYSSWIQE 264
            .||: ..|.|:.|:||:..|.||.: ||...|.:..|||||::
  Rat   212 GPLV-CGKGKVDGILSFSSKNCTDIFKPTVATAVAPYSSWIRK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 78/236 (33%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 78/238 (33%)
Trypsin 27..251 CDD:278516 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.