DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG33459

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:226 Identity:66/226 - (29%)
Similarity:104/226 - (46%) Gaps:31/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGG-------ADSLNSRKQTRFFVVERRW 117
            |..:.:.||.|.::::||||:||||:...| |.|.|..|       .||:|.:.:.|.::|.|.:
  Fly    55 LHNHLQFLCGGSLITSEFVLTAAHCVMPTP-KNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIY 118

  Fly   118 -HPQFRVLGGNDIAVLRIYPKFPLDDVRFRSINFAGKPQR--------DSGTQASLVGWGRVGVG 173
             ||.:|.:...|||:|::...... .|..|.|... .|:.        ||....:|.|||.....
  Fly   119 THPSYRSIAAYDIALLKLNQTVEY-TVAIRPICLV-LPENFHEWYWLVDSVEDFTLTGWGATKTE 181

  Fly   174 KIRKLQEMPFLT-MENDECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPL-MNVAKEKLY-- 234
            .:.::.:...|| ::...|...:.. .:....|||...|.  ..|.||||:|| |.|...:.|  
  Fly   182 PVSQVLQSANLTQIDRGTCHDRYGH-SVDHTHICAGSSKS--FACVGDSGSPLAMKVVHNRRYIH 243

  Fly   235 ---GLLSYGRKACTPLKPYAFTRINAYSSWI 262
               |::|.|.|.|..:.  .||.:.:::.||
  Fly   244 AQVGIVSRGPKNCDGVT--VFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 66/226 (29%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 64/224 (29%)
Tryp_SPc 38..272 CDD:238113 64/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.