DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and Sp212

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:281 Identity:67/281 - (23%)
Similarity:102/281 - (36%) Gaps:90/281 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 STTKVI----SF-RPRYPYIVSIGENLKGYYKHL------CVGVILSNEFVLSAAHCIQTNPTKQ 92
            |||..|    .| |.:||::.::      |:|.:      |.|.::|:..|:|||||:. ..|:.
  Fly   272 STTPFIVRGNEFPRGQYPWLSAV------YHKEVRALAFKCRGSLISSSIVISAAHCVH-RMTED 329

  Fly    93 LYVAG---------GADSLNSRKQTRFFVVERRWHPQF--RVLGGNDIAVLRIYPKFPLDDVRFR 146
            ..|.|         |.|....|...|..     |||.:  |.....|||::.|......:|:...
  Fly   330 RVVVGLGRYDLDDYGEDGAEMRNVMRLL-----WHPDYNTRSYSDADIALITIERPVTFNDIIAP 389

  Fly   147 SINFAGKPQRDSGTQASLVGWGRVGVGKIRKLQEMPFLTMENDE--------------------C 191
            ...:..:..|...|...:.||||                   ||                    |
  Fly   390 ICMWTVEASRTVSTTGFIAGWGR-------------------DEDSSRTQYPRVVEAEIASPTVC 435

  Fly   192 QQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEK--LYGLLSYGRKACTPLKPYAFTR 254
            ..:.|...:....:||.:..| .|||.||||..||....::  |.|::|.|.:.     |....:
  Fly   436 ASTWRGTMVTERSLCAGNRDG-SGPCVGDSGGGLMVKQGDRWLLRGIVSAGERG-----PAGTCQ 494

  Fly   255 INAY---------SSWIQESM 266
            :|.|         .:||.|::
  Fly   495 LNQYVLYCDLSKHINWISENI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 60/262 (23%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 63/273 (23%)
Tryp_SPc 277..511 CDD:214473 61/270 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.