DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG30375

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:242 Identity:62/242 - (25%)
Similarity:108/242 - (44%) Gaps:46/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNP--TKQLYVAG------GADSLNSRK 106
            :|.:|.: .:|.......|.|.|:|..::::||||....|  ::.|.:.|      ||:|:.:.:
  Fly   163 FPSMVGL-RDLSSNLPIFCGGSIVSERYIMTAAHCTARQPVASRLLALVGEHDLSTGAESIYAAQ 226

  Fly   107 QTRFFVVERRWHPQFRVLGG---NDIAVLR----------IYP-KFPLDDVRFRSINFAGKPQRD 157
            .....::.   ||.:.....   ||||:|:          :.| ..|:.... .|.|:       
  Fly   227 YRIQNIIN---HPGYMETASGNINDIALLQTATPIEWSRGVAPICLPIRQAE-NSFNY------- 280

  Fly   158 SGTQASLVGWGRVG--VGKIRKLQEMPFLTMENDECQQSHRF-VFLKPLDICAMHLKGPRG--PC 217
              ....::|||.:|  ..|...||:...|||:|..|:.  || ..:.|..:|. :..|.||  .|
  Fly   281 --QNVDIMGWGTLGFAASKSNTLQKATLLTMDNAVCRS--RFNSSITPSHLCT-YDAGGRGQDSC 340

  Fly   218 DGDSGAPLMNVAKEKLY--GLLSYGRKACTPLKPYAFTRINAYSSWI 262
            ..|||.|::...:|:::  |::||||....|......||:.::.:|:
  Fly   341 QYDSGGPVILRQRERMFQLGVISYGRACGQPFGIGVNTRVTSHLNWL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 62/242 (26%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 61/239 (26%)
Tryp_SPc 152..387 CDD:238113 61/240 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.