DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and svh-1

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:225 Identity:57/225 - (25%)
Similarity:101/225 - (44%) Gaps:18/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLY--VAGGADSLNSRKQTRFFV 112
            :|:..::..  |....|.|...||....:::||||.:.:.....|  |.|..|:..:....:.|.
 Worm   724 FPWTAALRN--KATKAHHCGASILDKTHLITAAHCFEEDERVSSYEVVVGDWDNNQTDGNEQIFY 786

  Fly   113 VER-RWHPQFRVLGGNDIAVLRI-YPKFPLDD----VRFRSINFAGKPQRDSGTQASLVGWGRVG 171
            ::| .::|.::.:..:|||:|.| ||....::    :...|.:|...|    |.|..:.|||.:|
 Worm   787 LQRIHFYPLYKDIFSHDIAILEIPYPGIEFNEYAQPICLPSKDFVYTP----GRQCVVSGWGSMG 847

  Fly   172 VGKIRKLQEMPFLTMENDECQQSHR-FVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKE---K 232
            :....:||......:...:|..|.: :..:.....||.:|:|....|.||||.|.....::   .
 Worm   848 LRYAERLQAALIPIINRFDCVNSSQIYSSMSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFV 912

  Fly   233 LYGLLSYGRKACTPLKPYAFTRINAYSSWI 262
            |.|::|:|.......:|..:|.:..|.|||
 Worm   913 LAGVISWGDGCAQKKQPGIYTMVAPYLSWI 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 57/225 (25%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 57/225 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.