DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and Gzme

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_034503.2 Gene:Gzme / 14942 MGIID:109265 Length:248 Species:Mus musculus


Alignment Length:230 Identity:63/230 - (27%)
Similarity:115/230 - (50%) Gaps:26/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RPRYPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTRFF 111
            ||...::.|:  :::|..:: |.|.::.::|||:||||.....|..|    ||.::.::::|:..
Mouse    32 RPYMAFVKSV--DIEGNRRY-CGGFLVQDDFVLTAAHCRNRTMTVTL----GAHNIKAKEETQQI 89

  Fly   112 --VVERRWHPQFRVLG-GNDIAVLRIYPKFPLDDVRFRSINFAGKPQRDS----GTQASLVGWGR 169
              |.:...||.:.... .:||.:|::..|..    |.:::.....|:.::    |...|:.|||.
Mouse    90 IPVAKAIPHPDYNATAFFSDIMLLKLESKAK----RTKAVRPLKLPRPNARVKPGDVCSVAGWGS 150

  Fly   170 VGVGKIR---KLQEMPFLTMENDECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKE 231
            ..:...:   :|:|...:..|::||::..|. :.:..:|||..||..:.|..||||.||  |...
Mouse   151 RSINDTKASARLREAQLVIQEDEECKKRFRH-YTETTEICAGDLKKIKTPFKGDSGGPL--VCDN 212

  Fly   232 KLYGLLSYGRKACTPLKPYAFTRINAYSSWIQESM 266
            |.||||:|.:.  ..:....||:|..:..||..:|
Mouse   213 KAYGLLAYAKN--RTISSGVFTKIVHFLPWISRNM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 60/224 (27%)
GzmeNP_034503.2 Tryp_SPc 20..241 CDD:214473 60/224 (27%)
Tryp_SPc 21..244 CDD:238113 62/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.