DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10038 and si:ch73-41e3.7

DIOPT Version :9

Sequence 1:NP_650176.3 Gene:CG10038 / 41495 FlyBaseID:FBgn0038013 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001139084.1 Gene:si:ch73-41e3.7 / 572312 ZFINID:ZDB-GENE-090313-163 Length:302 Species:Danio rerio


Alignment Length:305 Identity:87/305 - (28%)
Similarity:143/305 - (46%) Gaps:36/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PPASNCEEALIQLKNFGYAFDGEGVLRKVDPATGEPGKELFSYNVSDDAAENEKHYQKLANQIPE 86
            |.:|:.|        |.|:|..:|.||...  ||||.:  |.:::. ||.:.|...::|...:.:
Zfish     6 PESSDSE--------FPYSFSADGRLRHTH--TGEPYR--FQFHLR-DALQTETEQRRLCRFLTQ 57

  Fly    87 IVYALLEKNGLSRTYIPFDQPPERSSFVFSQPAKLSQSKKLLVLIHGSGYVKAGQWARSLIINNS 151
            .||.||::|        |....|....||..|..|..:..||:|:...|.|:.|.|:..:..:..
Zfish    58 HVYTLLQQN--------FQMRLEEHCSVFMTPGALEHAGCLLLLLQDRGTVRGGLWSWKITAHEG 114

  Fly   152 LDHGTQLPYVRQAQKLGYDLLITNANDCTRFYNGKENPIKGVNTSVEHVKYVWKNIVLPAKPESV 216
            |:.|:|:||:|.|....|.::|.|.|.  ..:|         .|..|||..||:.:|..:..:.|
Zfish   115 LETGSQIPYLRWALMENYAVIIMNPNG--DLHN---------KTPEEHVSEVWRRLVCVSAAQHV 168

  Fly   217 AIVAHSYGGSLTLDLVERFPDFFKESVFAIAFTDAAMG---SPQAK-NKEYLCDVACDWVASNTP 277
            .:|||.|||...:||:....:..:..|.|:||.|::..   .|..| .:::|...:..|:.|...
Zfish   169 FVVAHGYGGLAFVDLLCCRMEEVQRRVTAVAFLDSSHSLWHQPLGKAGRDWLRCHSRTWILSTKA 233

  Fly   278 LDTPVSQSKSSIRRISAGHTKHEWTSYSAIDSVFKFIEEKYEQRA 322
            |:..|...|:...:||||...|:......::|||:|..:..:.:|
Zfish   234 LNRSVGSLKAGCTQISAGTQCHDSAPAVCMESVFRFFSKTIKPKA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10038NP_650176.3 None
si:ch73-41e3.7NP_001139084.1 Arb2 55..140 CDD:286800 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54552
OrthoDB 1 1.010 - - D1036194at2759
OrthoFinder 1 1.000 - - FOG0004036
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21357
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.