DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10013 and IPA1

DIOPT Version :9

Sequence 1:NP_650175.2 Gene:CG10013 / 41494 FlyBaseID:FBgn0038012 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_012675.1 Gene:IPA1 / 853606 SGDID:S000003902 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:211 Identity:42/211 - (19%)
Similarity:76/211 - (36%) Gaps:53/211 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NVSQLIEVSPNGISWHEKNVEYRIIMDEFFDIITRTNAGD--------VPITLVEM--------- 84
            ::|.::|      .|  |.||.:.:.|....|     :||        :|:.:.|.         
Yeast    14 SISVVVE------GW--KQVEIKNLKDTLMSI-----SGDEEQVEDILLPVEVEEKVDASYKFKN 65

  Fly    85 KGSHVSFGLYLRRIRYSILDALTINVELG-----ELPMCISPYNSCSLHCSNCTNEIIGQRQYYH 144
            :|..:.:...||.....|.|:..:::..|     ||    ...:..|:.|.||..:||.:.....
Yeast    66 RGKDLEWMTKLRSKSSKIYDSSIMSLPDGRWTKEEL----RSDSDFSIECLNCKQKIISKDNCQV 126

  Fly   145 IQEVP--ITTILPQNYFCPRNRI-----------PVYPSEEELYYGLNYLVVCSELLGNGVKTIA 196
            :.::|  ....|...:.|.:..:           .:.||:.|:..|.:|.........| |.|..
Yeast   127 LNDMPSEFWFELMDYWHCHKPDVKEDKSSYTRFETLKPSKNEILIGSSYFQGTPATFEN-VATTK 190

  Fly   197 GRRRVLCSRCKKCVGE 212
            ....|||.:|...:|:
Yeast   191 ENDNVLCIKCSAVLGQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10013NP_650175.2 HECT_2 <125..>256 CDD:303071 22/101 (22%)
IPA1NP_012675.1 COG5629 4..347 CDD:227916 42/211 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4784
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.