DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10013 and Ube3d

DIOPT Version :9

Sequence 1:NP_650175.2 Gene:CG10013 / 41494 FlyBaseID:FBgn0038012 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001034699.1 Gene:Ube3d / 315863 RGDID:1306773 Length:370 Species:Rattus norvegicus


Alignment Length:246 Identity:53/246 - (21%)
Similarity:102/246 - (41%) Gaps:45/246 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GLYLRRIRYSILDALTINVELGELPMCISPYNS-------CSLHCSNCTNEIIGQRQYYHIQEVP 149
            ||:||           :..:....|..||.:|.       ||.:|.:|....|..|:...:..:|
  Rat    78 GLHLR-----------LRAQAESSPQPISGFNQSLQAQECCSFYCQSCGEVTIKDRKLLRVLPLP 131

  Fly   150 IT--TILPQNYFC---PRNRIPVYPSEEELYYGLNYLVVCSELLGNGVKTIAGRRRVLCSRCKKC 209
            ..  :.|...:.|   |....|::|.|.:.:.|.::.:|.|.  .:..:......:|:|.|||..
  Rat   132 SENWSALVGEWCCHPDPFANKPLHPRENDCFVGDSFFLVNSR--SDLEQEPKANTKVICKRCKVM 194

  Fly   210 VGEFITRDVGVQLYADALRFVTLDSPLEFKE-IFGHVTPTQIMMRLVND--GEICGPDQRRLFLK 271
            :||.::        ::..:|...:..::..| .|.::..:|.:..::..  .|:|  ..|..|..
  Rat   195 LGETVS--------SETTKFYMTEVIVQPSEGSFPNIPRSQFVQSVIARCLVELC--TARSTFRF 249

  Fly   272 AVR-PDGQLQLL--HLEMDTKQMHILRSELKLPDIKK-PDIDLPMEVDTSS 318
            .:: .||::.:|  .|..|:..|..|.|.   ..|:| |.::..:|.|:.|
  Rat   250 TIQGQDGKVYILLWVLNSDSLVMEPLSSS---GCIRKFPLLEDSLEADSGS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10013NP_650175.2 HECT_2 <125..>256 CDD:303071 27/136 (20%)
Ube3dNP_001034699.1 HECT_2 13..358 CDD:286852 53/246 (22%)
Interaction with UBE2C. /evidence=ECO:0000250 214..236 3/21 (14%)
HECT-like. /evidence=ECO:0000250 332..368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4784
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.