DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svp and nr2f6

DIOPT Version :9

Sequence 1:NP_001369011.1 Gene:svp / 41491 FlyBaseID:FBgn0003651 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001004841.1 Gene:nr2f6 / 448119 XenbaseID:XB-GENE-480818 Length:389 Species:Xenopus tropicalis


Alignment Length:389 Identity:255/389 - (65%)
Similarity:299/389 - (76%) Gaps:29/389 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 GQPTGCGSTTPSSQANSSHSQSSNSGSQIDSKQ--------NIECVVCGDKSSGKHYGQFTCEGC 220
            |...|.|...|   .||...::|..|...|.:|        .::||||||||||||||.||||||
 Frog    13 GDTNGVGKGYP---RNSEEEEASPQGGMSDPEQGDEERPGIQVDCVVCGDKSSGKHYGVFTCEGC 74

  Fly   221 KSFFKRSVRRNLTYSCRGSRNCPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGRVPP----TQPG 281
            ||||||||||||:|:||.:|:|.|||||||||||||||||.::|||:|||||||:||    ..|.
 Frog    75 KSFFKRSVRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPPAHSSASPT 139

  Fly   282 LAGMHGQYQIANGDPMGIAGFNGHSYLSSYISLLLRAEPYPTSRYG-QCMQPNNIMGIDNICELA 345
            .|...|:|            |||.. :|..||.||||||||.|||| |..|..::||||||||||
 Frog   140 SAPGAGEY------------FNGQP-VSELISQLLRAEPYPASRYGSQYAQQGSVMGIDNICELA 191

  Fly   346 ARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMA 410
            ||||||.|||::|||:||||.:.|||:||||.|||||||:|:|.::|||:||||||||.|||||:
 Frog   192 ARLLFSTVEWSRNIPYFPELAMADQVSLLRLSWSELFVLSAAQSALPLHMAPLLAAAGFHASPMS 256

  Fly   411 ADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALE 475
            |||||:|||.||:||:|||||..|.||||||:|||||.|||:|||||:|..|:||||||:|.||.
 Frog   257 ADRVVSFMDQIRLFQDQVEKLNRLQVDSAEYACLKAIALFTSDACGLTDPAHVESLQEKAQVALT 321

  Fly   476 EYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFFVRLVGKTPIETLIRDMLLSGNSFSWPY 539
            ||.|.|||:||.|||:||||||:||.|.:.:|.||||:|||||||||||||||||||:||:|||
 Frog   322 EYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSSFNWPY 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svpNP_001369011.1 NR_DBD_COUP_TF 200..272 CDD:143516 60/71 (85%)
NR_LBD_COUP-TF 307..542 CDD:132746 172/234 (74%)
nr2f6NP_001004841.1 NR_DBD_COUP_TF 54..126 CDD:143516 60/71 (85%)
NR_LBD_COUP-TF 152..388 CDD:132746 172/235 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2287
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D296293at33208
OrthoFinder 1 1.000 - - FOG0001162
OrthoInspector 1 1.000 - - otm48542
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3161
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.