DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svp and tll

DIOPT Version :9

Sequence 1:NP_001369011.1 Gene:svp / 41491 FlyBaseID:FBgn0003651 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster


Alignment Length:456 Identity:137/456 - (30%)
Similarity:197/456 - (43%) Gaps:125/456 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 SSNSGSQIDSKQN---------------IECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY 234
            |..|...:|.|.|               :.|.||.|.|||||||.:.|:||..|||||:||:..|
  Fly     4 SEGSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQY 68

  Fly   235 SCRGSRN--CPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGR----------------------- 274
            .|:..:.  |.:|:.|||||:.|||:||.::||.::|||..|                       
  Fly    69 VCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGE 133

  Fly   275 --------------------VPPTQPGL---AGMHGQYQIANGDPMGIAG--------------F 302
                                ||...|||   ||.|..:..|...|...|.              .
  Fly   134 MPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVH 198

  Fly   303 NGH----SYLSSYI-SLLLRAEPYPTSRYGQCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFF 362
            .||    |..::|: :|..||.| ||.         .:|..::|.|.||..||..|.|.|::..|
  Fly   199 QGHHGFFSPTAAYMNALATRALP-PTP---------PLMAAEHIKETAAEHLFKNVNWIKSVRAF 253

  Fly   363 PELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMD-HIRIFQE 426
            .||.:.||:.||...|.|.|:|..:|..||::.|.||.   ::.|..|...::..:. .:..|||
  Fly   254 TELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLF---VYESENANREIMGMVTREVHAFQE 315

  Fly   427 QVEKLKALHVDSAEYSCLKAIVLF-----------------------------TTDACGLSDVTH 462
            .:.:|..|::||.||.||:||.||                             :.::.||.:...
  Fly   316 VLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGK 380

  Fly   463 IESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFFVRLVGKTPIETLIRD 527
            :.::...::.||..|.:..:|:||.||..||..:..:..|||..||:|||.:.:|...|..||.|
  Fly   381 VAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISD 445

  Fly   528 M 528
            |
  Fly   446 M 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svpNP_001369011.1 NR_DBD_COUP_TF 200..272 CDD:143516 39/73 (53%)
NR_LBD_COUP-TF 307..542 CDD:132746 77/253 (30%)
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 41/91 (45%)
NR_LBD 215..436 CDD:416257 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I7416
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34630at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
55.020

Return to query results.
Submit another query.