DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svp and Hr83

DIOPT Version :9

Sequence 1:NP_001369011.1 Gene:svp / 41491 FlyBaseID:FBgn0003651 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster


Alignment Length:306 Identity:92/306 - (30%)
Similarity:134/306 - (43%) Gaps:64/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRG-SRNCPIDQHHRNQCQYCRLKKCLKM 263
            |.||||:|||||||...|:||..||||||||..:|:|.. ..||.:|:..||.|..||.::||.:
  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71

  Fly   264 GMRREAVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFNGHSYLSSYISLLLRAEPYPTSRYGQ 328
            ||...|||..|.|..|.......|:.|....                      :|.|.||. :.|
  Fly    72 GMNAAAVQEERGPRNQQVALYRTGRRQAPPS----------------------QAAPSPTP-HSQ 113

  Fly   329 CMQPNNIMGIDNICELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPL 393
            .:.          .::.|::|.:.:..||....|..|....|.|:.::||||:|||.||..|  |
  Fly   114 ALH----------FQILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWS--L 166

  Fly   394 HVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKL----KALHVDSAEYSCLKAIVLFTTDA 454
            .::.::...|                     .||:::|    ..|..|..|.:.:::::|...:.
  Fly   167 DISAMIDGCG---------------------DEQLKRLICEAHQLRADVLELNFMESLILCRKEL 210

  Fly   455 CGLSDVTHIESLQEKSQCALEEYCR-TQYPNQPTRFGKLLLRLPSL 499
            ...::...|  |...|:.||....| |...:...|||:|||.|..|
  Fly   211 AINAEYAVI--LGSHSKAALISLARYTLQQSNYLRFGQLLLGLRQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svpNP_001369011.1 NR_DBD_COUP_TF 200..272 CDD:143516 39/72 (54%)
NR_LBD_COUP-TF 307..542 CDD:132746 47/198 (24%)
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 42/80 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.