DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svp and nr2f6a

DIOPT Version :9

Sequence 1:NP_001369011.1 Gene:svp / 41491 FlyBaseID:FBgn0003651 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_991120.1 Gene:nr2f6a / 325637 ZFINID:ZDB-GENE-030131-4362 Length:402 Species:Danio rerio


Alignment Length:435 Identity:259/435 - (59%)
Similarity:307/435 - (70%) Gaps:58/435 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GGHHSGSGSGSGSGVNPGHGSDMLPLIKGHGQDMLTSIKGQPTGCGSTTPSSQANSSHSQSSNSG 189
            ||....:|..:|.| :.|:       ::|...|      |.|.|.||...:.:        .:.|
Zfish     6 GGWGDPNGETNGLG-DKGY-------LRGDEDD------GSPQGGGSDMEAGE--------DDKG 48

  Fly   190 SQIDSKQNIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRGSRNCPIDQHHRNQCQY 254
            ..:|      ||||||||||||||.||||||||||||||||||.|:||.:|:|.|||||||||||
Zfish    49 CVVD------CVVCGDKSSGKHYGVFTCEGCKSFFKRSVRRNLNYTCRSNRDCQIDQHHRNQCQY 107

  Fly   255 CRLKKCLKMGMRREAVQRGRVPP--------TQP--GLAGMHGQYQIANGDPMGIAGFNGHSYLS 309
            ||||||.::|||:|||||||:||        |.|  |.|| .|..:..||.|           :|
Zfish   108 CRLKKCFRVGMRKEAVQRGRIPPSHSSLSPSTTPVGGNAG-GGVSEFYNGQP-----------VS 160

  Fly   310 SYISLLLRAEPYPTSR----YGQCMQ----PNNIMGIDNICELAARLLFSAVEWAKNIPFFPELQ 366
            ..||.||||||||.||    |.|.||    ..:.||||:|||||||||||.:|||:|||:||||.
Zfish   161 ELISQLLRAEPYPNSRYSHQYNQQMQGGGGGGSGMGIDSICELAARLLFSIIEWARNIPYFPELP 225

  Fly   367 VTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKL 431
            |::|||||||.|||||:|||:|.::|||:||||||||.|:|||:|:|||:|||.:|:||:|||||
Zfish   226 VSEQVALLRLSWSELFILNAAQSALPLHMAPLLAAAGFHSSPMSAERVVSFMDQVRVFQDQVEKL 290

  Fly   432 KALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRL 496
            ..|.||||||||||||.||:.|||||:|..|:||||||:|.||.||.|.|||.||.|||:|||||
Zfish   291 TRLQVDSAEYSCLKAIALFSPDACGLTDPAHVESLQEKAQVALTEYERMQYPGQPQRFGRLLLRL 355

  Fly   497 PSLRTVSSQVIEQLFFVRLVGKTPIETLIRDMLLSGNSFSWPYLP 541
            |:||.|.:.:|.||||:|||||||||||||||.|||:|.||||.|
Zfish   356 PALRAVPASLISQLFFMRLVGKTPIETLIRDMQLSGSSISWPYAP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svpNP_001369011.1 NR_DBD_COUP_TF 200..272 CDD:143516 60/71 (85%)
NR_LBD_COUP-TF 307..542 CDD:132746 169/243 (70%)
nr2f6aNP_991120.1 NR_DBD_COUP_TF 53..125 CDD:143516 60/71 (85%)
NR_LBD_COUP-TF 158..401 CDD:132746 170/254 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2291
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D296293at33208
OrthoFinder 1 1.000 - - FOG0001162
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24083
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3161
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.