DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svp and nr2f1a

DIOPT Version :9

Sequence 1:NP_001369011.1 Gene:svp / 41491 FlyBaseID:FBgn0003651 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_571255.1 Gene:nr2f1a / 30418 ZFINID:ZDB-GENE-980526-115 Length:411 Species:Danio rerio


Alignment Length:368 Identity:310/368 - (84%)
Similarity:334/368 - (90%) Gaps:13/368 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PSSQANSSHSQSSNSGSQIDSKQNIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRG 238
            ||:...:....|.|||   .|:|:|||||||||||||||||||||||||||||||||||||:||.
Zfish    53 PSTPGTAGDKGSQNSG---QSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRA 114

  Fly   239 SRNCPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFN 303
            :|||||||||||||||||||||||:|||||||||||:|||||.    .|||.:.||||:     |
Zfish   115 NRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPN----PGQYALTNGDPL-----N 170

  Fly   304 GHSYLSSYISLLLRAEPYPTSRYG-QCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFFPELQV 367
            ||.|||.||||||||||||||||| |||||||||||:|||||||||||||||||:||||||:||:
Zfish   171 GHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQI 235

  Fly   368 TDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLK 432
            ||||:||||.|||||||||:||||||||||||||||||||||:||||||||||||||||||||||
Zfish   236 TDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLK 300

  Fly   433 ALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLP 497
            |||||||||||:|||||||:|||||||..||||||||||||||||.|:||||||:||||||||||
Zfish   301 ALHVDSAEYSCIKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP 365

  Fly   498 SLRTVSSQVIEQLFFVRLVGKTPIETLIRDMLLSGNSFSWPYL 540
            |||||||.|||||||||||||||||||||||||||:||:|||:
Zfish   366 SLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svpNP_001369011.1 NR_DBD_COUP_TF 200..272 CDD:143516 67/71 (94%)
NR_LBD_COUP-TF 307..542 CDD:132746 214/235 (91%)
nr2f1aNP_571255.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68 4/14 (29%)
gliding_GltJ <11..>59 CDD:411345 2/5 (40%)
NR_DBD_COUP_TF 76..148 CDD:143516 67/71 (94%)
NR_LBD_COUP-TF 174..409 CDD:132746 214/235 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2291
eggNOG 1 0.900 - - E33208_3BBKC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D296293at33208
OrthoFinder 1 1.000 - - FOG0001162
OrthoInspector 1 1.000 - - otm25721
orthoMCL 1 0.900 - - OOG6_106204
Panther 1 1.100 - - LDO PTHR24083
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3161
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.