DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment svp and nr2f2

DIOPT Version :9

Sequence 1:NP_001369011.1 Gene:svp / 41491 FlyBaseID:FBgn0003651 Length:826 Species:Drosophila melanogaster
Sequence 2:XP_012813815.1 Gene:nr2f2 / 100038039 XenbaseID:XB-GENE-482566 Length:415 Species:Xenopus tropicalis


Alignment Length:408 Identity:321/408 - (78%)
Similarity:348/408 - (85%) Gaps:28/408 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 PGHGSDMLPLIKGHGQDMLTSIKGQPTGCGSTTPSSQANSSHSQSSNSGSQIDSKQNIECVVCGD 205
            ||.|.        :|........||  |..|||| :|:|.|...|.|.|.:...:|:||||||||
 Frog    25 PGQGP--------NGAPHTPQTPGQ--GVPSTTP-AQSNPSSQPSQNQGEKQQQQQHIECVVCGD 78

  Fly   206 KSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRGSRNCPIDQHHRNQCQYCRLKKCLKMGMRRE-- 268
            |||||||||||||||||||||||||||||:||.:|||||||||||||||||||||||:|||||  
 Frog    79 KSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREVS 143

  Fly   269 -----AVQRGRVPPTQPGLAGMHGQYQIANGDPMGIAGFNGHSYLSSYISLLLRAEPYPTSRYG- 327
                 ||||||:|||||    .|||:.:.||||:     |.|||||.|||||||||||||||:| 
 Frog   144 SLFTAAVQRGRMPPTQP----THGQFALTNGDPL-----NCHSYLSGYISLLLRAEPYPTSRFGS 199

  Fly   328 QCMQPNNIMGIDNICELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMP 392
            |||||||||||:||||||||:||||||||:||||||:||:|||||||||.|||||||||:|||||
 Frog   200 QCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMP 264

  Fly   393 LHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGL 457
            |||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||:|||||
 Frog   265 LHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGL 329

  Fly   458 SDVTHIESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFFVRLVGKTPIE 522
            |||.|:||||||||||||||.|:||||||||||||||||||||||||.|||||||||||||||||
 Frog   330 SDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIE 394

  Fly   523 TLIRDMLLSGNSFSWPYL 540
            ||||||||||:||:|||:
 Frog   395 TLIRDMLLSGSSFNWPYM 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svpNP_001369011.1 NR_DBD_COUP_TF 200..272 CDD:143516 67/78 (86%)
NR_LBD_COUP-TF 307..542 CDD:132746 215/235 (91%)
nr2f2XP_012813815.1 NR_DBD_COUP_TF 73..143 CDD:143516 65/69 (94%)
NR_LBD_COUP-TF 178..413 CDD:132746 215/235 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2287
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H7628
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D296293at33208
OrthoFinder 1 1.000 - - FOG0001162
OrthoInspector 1 1.000 - - otm48542
Panther 1 1.100 - - O PTHR24083
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3161
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.