powered by:
Protein Alignment CG17738 and fipr-23
DIOPT Version :9
Sequence 1: | NP_650172.1 |
Gene: | CG17738 / 41490 |
FlyBaseID: | FBgn0038009 |
Length: | 110 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493469.1 |
Gene: | fipr-23 / 173283 |
WormBaseID: | WBGene00007990 |
Length: | 191 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 25/71 - (35%) |
Similarity: | 40/71 - (56%) |
Gaps: | 8/71 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 EESINQSNDLSSVEKDIGQAVESD---VRAKRQFGFGGPFGGFGGPFG-GYGGYG---GLGGFGY 79
|..|......|.|:.::.|.:::: :| .|::|:.|..||:|..:| ||||.| |:..|||
Worm 122 ESQIKMEGQGSGVKTEMNQQMDAEAPHIR-DRRWGYYGGMGGYGMGYGMGYGGMGYGMGMRRFGY 185
Fly 80 GRPFYG 85
|.|.:|
Worm 186 GYPMWG 191
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR36521 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.