DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17738 and C37A5.6

DIOPT Version :9

Sequence 1:NP_650172.1 Gene:CG17738 / 41490 FlyBaseID:FBgn0038009 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001252300.1 Gene:C37A5.6 / 13182953 WormBaseID:WBGene00014700 Length:87 Species:Caenorhabditis elegans


Alignment Length:88 Identity:27/88 - (30%)
Similarity:43/88 - (48%) Gaps:12/88 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FGLIVCLAFSLVLSLEESINQSNDLSSVEKDIG-----QAVESDVRA----KRQFGFGGPFGGFG 62
            |..:..||...:.:|.:::..:.......|.:|     ...|.|..|    .|::|:.|.:||:|
 Worm     3 FVSLFLLAILAIGALSDTVTNTKMKVDTTKPVGAPQTEMHTEMDSEAPHTRNRRWGYYGGYGGYG 67

  Fly    63 GPFGGYGGYGGLGGFGYGRPFYG 85
            ..  ||||| |:.|:|||.|.:|
 Worm    68 RM--GYGGY-GMRGYGYGYPMWG 87



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR36521
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.