DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAX and Max

DIOPT Version :9

Sequence 1:NP_002373.3 Gene:MAX / 4149 HGNCID:6913 Length:160 Species:Homo sapiens
Sequence 2:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster


Alignment Length:177 Identity:73/177 - (41%)
Similarity:108/177 - (61%) Gaps:41/177 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSDND-DIEVESDEE--------------QPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSV 50
            |||:| ||::||||:              ...| :.|:||||||||||:||||||:||.:||::|
  Fly     3 MSDDDRDIDIESDEDGDSDTGLGSSRHTNTANF-TQAEKRAHHNALERRRRDHIKESFTNLREAV 66

Human    51 PSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNY 115
            |:|:||||||||||.|.||.||.||||...:|:||:::||||.::.:|::|||            
  Fly    67 PTLKGEKASRAQILKKTTECIQTMRRKISENQKDIEEIKRQNNIIAKQIQALE------------ 119

Human   116 PSSDNSLYTNAKGSTISAF----DGGSDSSSESEPEEPQSRKKLRME 158
                     ::.|...|.|    :.||:.:.:.:.::..||:..:|:
  Fly   120 ---------SSNGDQFSEFLSDEEVGSEEADDEDLDQDFSRRNKKMK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAXNP_002373.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 26/53 (49%)
bHLHzip_Max 24..92 CDD:381412 47/67 (70%)
Leucine-zipper 81..102 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..160 9/60 (15%)
Nuclear localization signal 152..156 1/3 (33%)
MaxNP_001246833.1 HLH 40..91 CDD:278439 38/50 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148044
Domainoid 1 1.000 81 1.000 Domainoid score I8588
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4778
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545748at2759
OrthoFinder 1 1.000 - - FOG0005533
OrthoInspector 1 1.000 - - oto88407
orthoMCL 1 0.900 - - OOG6_104805
Panther 1 1.100 - - LDO PTHR10328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4638
SonicParanoid 1 1.000 - - X5516
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.