DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAX and Max

DIOPT Version :9

Sequence 1:NP_002373.3 Gene:MAX / 4149 HGNCID:6913 Length:160 Species:Homo sapiens
Sequence 2:NP_032584.2 Gene:Max / 17187 MGIID:96921 Length:160 Species:Mus musculus


Alignment Length:160 Identity:159/160 - (99%)
Similarity:159/160 - (99%) Gaps:0/160 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILD 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILD 65

Human    66 KATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGST 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|
Mouse    66 KATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGGT 130

Human   131 ISAFDGGSDSSSESEPEEPQSRKKLRMEAS 160
            ||||||||||||||||||||||||||||||
Mouse   131 ISAFDGGSDSSSESEPEEPQSRKKLRMEAS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAXNP_002373.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 38/38 (100%)
bHLHzip_Max 24..92 CDD:381412 67/67 (100%)
Leucine-zipper 81..102 20/20 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..160 55/56 (98%)
Nuclear localization signal 152..156 3/3 (100%)
MaxNP_032584.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 38/38 (100%)
bHLHzip_Max 24..92 CDD:381412 67/67 (100%)
Leucine-zipper 81..102 20/20 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..160 54/55 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83961537
Domainoid 1 1.000 169 1.000 Domainoid score I30415
eggNOG 1 0.900 - - E1_KOG2483
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1786
Inparanoid 1 1.050 315 1.000 Inparanoid score I14914
Isobase 1 0.950 - 0 Normalized mean entropy S2479
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG46640
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005533
OrthoInspector 1 1.000 - - oto113002
orthoMCL 1 0.900 - - OOG6_104805
Panther 1 1.100 - - LDO PTHR10328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4638
SonicParanoid 1 1.000 - - X5516
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1818.240

Return to query results.
Submit another query.