DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and PGC1

DIOPT Version :9

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_015118.1 Gene:PGC1 / 855895 SGDID:S000006127 Length:321 Species:Saccharomyces cerevisiae


Alignment Length:388 Identity:76/388 - (19%)
Similarity:143/388 - (36%) Gaps:119/388 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 IGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVLRFMLQRMPS 434
            :||:.....|       .||||..|::|..|.||::|.|:|:|.|..|||.||           |
Yeast     5 VGHRAFKARY-------PENTLLAFEKAYAAGADVIETDLQMTSDGMVVVNHD-----------S 51

  Fly   435 FEDLLENQDLLI--FAYENLNKLMLLAMGGSKRKDLIAVPLEAFSYDQLKEVKVLRFAGSKGCDK 497
            ....:.:::|:|  ..:|.:.:|.....|......|..:...|..:...|.:..::|...|    
Yeast    52 DTGRMWDKNLVIGESTWEEVKRLRCKEDGSLAMMTLKEILTWAVCHPGAKLMLDIKFTNEK---- 112

  Fly   498 SCDRMLLEQRPFPLLLDLLDEENLPVDMGFLIEIKWPQMTNMRRW---------ESGSFKPTFDR 553
                 ::..:.|.::|::.:      |:.|     |.:......|         |:|..|     
Yeast   113 -----IIMIKTFVIMLEVKN------DLKF-----WQERITWGLWLLDWYDFGIETGVLK----- 156

  Fly   554 NFYVDTILEIVLNKAGKRRIVFCSFDADICAMVRFKQNVYPVTLLLEDPHSPVQYADQRVSVQDV 618
            :|                :::..|...||.:  :|.:.    :|.|.|||         ..:..:
Yeast   157 DF----------------KVIVISLSLDIAS--QFVKR----SLTLNDPH---------YKLFGI 190

  Fly   619 AVRFCNS------LEFLGLTLHANSL------LNKPSTMAYLHQINLDAFVYGSSTID-LEIRNK 670
            :|.|.:|      |..|.: |..|.:      :|||....||.::.    ::|:.|.| ::.|..
Yeast   191 SVHFVSSWTSQFRLRLLPV-LMKNDIKVYLWTVNKPIDFKYLCELP----IHGAITDDPIKARKL 250

  Fly   671 LKKHGVLGIIYDRLDQLDQVGEELEGDTMCTIDSVTTRRVIQETEV------EEW--IQKCGY 725
            ...|.|.        :.....::....::.::|.:.....|:...:      .:|  |:.||:
Yeast   251 CDGHTVA--------KKPTAEKKFVAPSLASVDGLRFHAFIKVYNILCTLLYSKWVHIKLCGW 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 70/337 (21%)
GDPD 372..685 CDD:281062 69/336 (21%)
PGC1NP_015118.1 GDPD_YPL206cp_fungi 4..244 CDD:176512 66/317 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.