DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and GDPD3

DIOPT Version :9

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_077283.2 Gene:GDPD3 / 79153 HGNCID:28638 Length:318 Species:Homo sapiens


Alignment Length:164 Identity:38/164 - (23%)
Similarity:66/164 - (40%) Gaps:62/164 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 PNFRCDLSHSYERYWRKNRLCMNIGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQL 411
            |.||..|.                .|:|       ||..:.|||:...:.::...:|::|:|.||
Human    35 PTFRIRLG----------------AHRG-------GSGELLENTMEAMENSMAQRSDLLELDCQL 76

  Fly   412 TQDAQVVVYHDFVLRFMLQRMPSFEDLLE----NQDLLIFAYENL----NKLML------LAMGG 462
            |:|..|||.||             |:|..    |:|:....:|:|    .||.:      .|.|.
Human    77 TRDRVVVVSHD-------------ENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGS 128

  Fly   463 SKR----KDL--------IAVPLEAFSYDQLKEV 484
            .:|    :||        ::|.::..:.:.::|:
Human   129 DRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 34/143 (24%)
GDPD 372..685 CDD:281062 34/139 (24%)
GDPD3NP_077283.2 GDPD_GDE4 13..310 CDD:176553 38/164 (23%)
GDPD 44..301 CDD:281062 34/139 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.