DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and Gdpd2

DIOPT Version :9

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001292870.1 Gene:Gdpd2 / 71584 MGIID:1918834 Length:539 Species:Mus musculus


Alignment Length:360 Identity:73/360 - (20%)
Similarity:125/360 - (34%) Gaps:135/360 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 IGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVLRFMLQRMPS 434
            :||:|:       ..:..||||...::.....|.:.|.||.::.|....:.||            
Mouse   228 VGHRGA-------PMLAPENTLMSLRKTAECGAAVFETDVMVSSDGVPFLMHD------------ 273

  Fly   435 FEDLLENQDLLIFAYENLNKLMLLAMGGSKRKDLIAVPLEAFSYDQLKEVKV-------LRFAGS 492
                           |.|::...:|   |...:.|:.....||:.:|:.:..       ..|.|:
Mouse   274 ---------------ERLSRTTNVA---SVFPERISAHSSDFSWAELQRLNAGTWFLERQPFWGA 320

  Fly   493 KGCDKSCDRMLLEQRPFPLLLDLLDEE---NLPVDMGFLIEIKWPQMTNMRRWESGSFKPTFDRN 554
            |....| ||...|.:..|.|.:||.|.   ||.:            |.::||       |..:..
Mouse   321 KKLSGS-DRKEAENQTIPALEELLKEAAALNLSI------------MFDLRR-------PPRNHT 365

  Fly   555 FY---VDTILEIVLNKAGKRRIVFCSFDADIC-AMVRFKQNVYPVTLLLEDPHSPVQYADQRVSV 615
            :|   |:..||.||:             |::. |||          |.|.|        :.|.:|
Mouse   366 YYDTFVNQTLEAVLS-------------ANVSQAMV----------LWLPD--------EDRANV 399

  Fly   616 QDVAVR-----------FCNSLEFLGL-----------TLHANSL------LNKPSTMAYLHQIN 652
            |..|.|           :....:||.|           .||.:::      :|||...:.|....
Mouse   400 QQRAPRMRQIYGHQGGNWTERPQFLNLPYQDLPALDIKALHQDNISVNLFVVNKPWLFSLLWCAG 464

  Fly   653 LDAFVYGSSTIDLEIRNKL-----KKHGVLGIIYD 682
            :|:....:..:..:::|.|     :|:.::.:|.|
Mouse   465 VDSVTTNACQLLQQMQNPLWLLPPQKYLMIWVITD 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 73/360 (20%)
GDPD 372..685 CDD:281062 72/358 (20%)
Gdpd2NP_001292870.1 PI-PLCc_GDPD_SF 198..500 CDD:417475 73/360 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.