DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and Gdpd4

DIOPT Version :9

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_006229858.1 Gene:Gdpd4 / 680990 RGDID:1585799 Length:739 Species:Rattus norvegicus


Alignment Length:232 Identity:43/232 - (18%)
Similarity:81/232 - (34%) Gaps:73/232 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 NIGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVL---RFMLQ 430
            |:|.|.:...:|....:..|||:..|::||......:|.|:.::.|....:.||:.|   ..:::
  Rat   270 NLGPKPALFGHRGAPMLAPENTMMSFEKAVEFGVSGLETDIYVSVDHVPFLMHDYDLTRTTNIIE 334

  Fly   431 RMPSFEDLLENQDLLIFAYENLNKLMLLAMGGS----KRKDLIAVPLEAFSYDQLKEVKVLRFAG 491
            .:||   ...|..      .|.|...|.::...    |.|..       |....|.|....| ||
  Rat   335 VLPS---AASNHS------SNFNWTFLSSLNAGQWFLKHKPF-------FGMKPLSEADQKR-AG 382

  Fly   492 SKGCDKSCDRMLLEQRPFPLLLDLLDEENLPVDMGFLIEIKWPQMTNMRRWESGSFKPTFD---- 552
            ::...:..:.:.|.:|...::|                                     ||    
  Rat   383 NQSIPQLSEFLELAKREEKIVL-------------------------------------FDLFGP 410

  Fly   553 ------RNFYVDTILEIVLNKAGKRRIVFC--SFDAD 581
                  ||.:|..::.::|:...::|::|.  .||.:
  Rat   411 PPGHPLRNTFVRRVVRVILDSKIEQRLIFWLPGFDRE 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 43/232 (19%)
GDPD 372..685 CDD:281062 41/229 (18%)
Gdpd4XP_006229858.1 MFS <66..>206 CDD:304372
PI-PLCc_GDPD_SF 253..566 CDD:301322 43/232 (19%)
GDPD 280..527 CDD:281062 40/222 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.