powered by:
Protein Alignment CG3942 and Gdpd1
DIOPT Version :9
Sequence 1: | NP_650171.2 |
Gene: | CG3942 / 41489 |
FlyBaseID: | FBgn0038008 |
Length: | 739 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079914.1 |
Gene: | Gdpd1 / 66569 |
MGIID: | 1913819 |
Length: | 314 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 26/66 - (39%) |
Similarity: | 37/66 - (56%) |
Gaps: | 8/66 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 362 RKNR-LCMNIGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVL 425
:|.| |..:|.|:| |:....|||:..|:.||....||:|:|..:|:|.||||.||..|
Mouse 34 KKQRFLSRHISHRG-------GAGENLENTMAAFQHAVTIGTDMLELDCHITKDEQVVVSHDANL 91
Fly 426 R 426
:
Mouse 92 K 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0584 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.