DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and gdpd5b

DIOPT Version :10

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_005157799.1 Gene:gdpd5b / 560645 ZFINID:ZDB-GENE-030131-6028 Length:584 Species:Danio rerio


Alignment Length:86 Identity:23/86 - (26%)
Similarity:39/86 - (45%) Gaps:8/86 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 IGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVLRFMLQRMPS 434
            |||:|:       ..:..||||..|.:|:..|...:|.||.::.|....:..|..||........
Zfish   231 IGHQGA-------PMLAPENTLLSFNRALQRNVSGLETDVTISLDGVPFLMRDRTLRRTTNVRRV 288

  Fly   435 FEDLLENQDLLIFAYENLNKL 455
            |.: .:.:|..:|.:.:|:.|
Zfish   289 FPE-RQYEDASLFNWTDLSTL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 23/86 (27%)
gdpd5bXP_005157799.1 GDPD_GDE2 227..582 CDD:176550 23/86 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.