DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and GDPD2

DIOPT Version :9

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001164663.1 Gene:GDPD2 / 54857 HGNCID:25974 Length:590 Species:Homo sapiens


Alignment Length:416 Identity:84/416 - (20%)
Similarity:143/416 - (34%) Gaps:150/416 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 IGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVLRFMLQRMPS 434
            :||:|:       ..:..||||...::.....|.:.|.||.::.|....:.||            
Human   227 VGHRGA-------PMLAPENTLMSLRKTAECGATVFETDVMVSSDGVPFLMHD------------ 272

  Fly   435 FEDLLENQDLLIFAYENLNKLMLLAMGGSKRKDLIAVPLEAFSYDQLKEVKVLRFAGSKGCDKSC 499
                           |:|::...:|.....|   |......||:.:||.:.    |||       
Human   273 ---------------EHLSRTTNVASVFPTR---ITAHSSDFSWTELKRLN----AGS------- 308

  Fly   500 DRMLLEQRPF-------------------PLLLDLLDEENLPVDMGFLIEIKWPQMTNMRRWESG 545
              ..||:|||                   |.|.:|| ||...:::..:.:::.|...:       
Human   309 --WFLERRPFWGAKPLAGPDQKEAESQTVPALEELL-EEAAALNLSIMFDLRRPPQNH------- 363

  Fly   546 SFKPTFDRNFYVDTILEIVLNKAGKRRIVFCSFDADICAMVR---FKQNVY----------PVTL 597
                |:...|.:.| ||.|||....:.:||...|.|...:.|   ..:.:|          |..|
Human   364 ----TYYDTFVIQT-LETVLNARVPQAMVFWLPDEDRANVQRRAPGMRQIYGRQGGNRTERPQFL 423

  Fly   598 LLEDPHSPVQYADQRVSVQDVAVRFCNSLEFLGLTLHANSLLN---------------KPSTMAY 647
            .|  |:       |.:.:.|:..||....: .||.|.|:|.|.               .|....|
Human   424 NL--PY-------QDLPLLDIKDRFLLPAQ-AGLKLLASSNLPASASQSAGITGLSHCPPQPPGY 478

  Fly   648 LHQINLDAFVY--GSSTIDLEIRNKLKKHGVLGIIYDRLDQLDQVGEELEGDTMCT-IDSVTTR- 708
            .|:::..|...  .:.:::|.:.||.....:|                     .|. :|||||. 
Human   479 KHELSHLAMALHKDNVSVNLFVVNKPWLFSLL---------------------WCAGVDSVTTND 522

  Fly   709 -RVIQETEVEEWIQKCGYKPETSIVV 733
             :::|:.....|:    ..|:|.:::
Human   523 CQLLQQMRYPIWL----ITPQTYLII 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 74/362 (20%)
GDPD 372..685 CDD:281062 73/361 (20%)
GDPD2NP_001164663.1 PI-PLCc_GDPD_SF 202..563 CDD:326331 84/416 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.