DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and gdpd1

DIOPT Version :9

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001004118.1 Gene:gdpd1 / 445504 ZFINID:ZDB-GENE-040822-22 Length:318 Species:Danio rerio


Alignment Length:270 Identity:56/270 - (20%)
Similarity:92/270 - (34%) Gaps:120/270 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 RC-DLSHSYERYWRKNRLCMNIGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQ 413
            :| .|.|..:|...::|   :|.|:|       |:....|||:..||.||....||:|:|..||:
Zfish    23 KCPSLLHRRKREAFRSR---HISHRG-------GAGENLENTMAAFKHAVKLGTDMLELDCHLTK 77

  Fly   414 DAQVVVYHDFVLRFML------------------------------------QRMPSFEDLLE-- 440
            |.||||.||..|:...                                    :|:|...|:.|  
Zfish    78 DEQVVVLHDSSLKRSTGINAYVADVAYADLPPYLCKLGVSFKRDCYCEGGEDKRIPLLRDVFEAF 142

  Fly   441 -----------NQDLLIFAYENLNKLML------LAMGGSKRKDLIAVPLEAFSYDQLKEVKVLR 488
                       |.|.||   :.:::|::      |.:.|:...:::                   
Zfish   143 PSTPVNIDIKVNNDTLI---KKVSELVIQYKRQDLTVWGNSSNEIV------------------- 185

  Fly   489 FAGSKGCDKSCDRMLLEQRPFPLLLDL-------------------LDEENLPVDMGFLI-EIKW 533
                |.|.|       |....|:|..|                   :.|:.|.:.|..:: ::|.
Zfish   186 ----KKCHK-------ENPQIPILFSLPRVLLLLGLFYTGLLPFVPIKEQFLEIPMPSIVSKLKD 239

  Fly   534 PQ-MTNMRRW 542
            || .|..:|:
Zfish   240 PQRQTRSQRF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 51/251 (20%)
GDPD 372..685 CDD:281062 50/247 (20%)
gdpd1NP_001004118.1 GDPD_GDE4 12..310 CDD:176553 56/270 (21%)
UgpQ 41..307 CDD:223657 51/249 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.