Sequence 1: | NP_650171.2 | Gene: | CG3942 / 41489 | FlyBaseID: | FBgn0038008 | Length: | 739 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004118.1 | Gene: | gdpd1 / 445504 | ZFINID: | ZDB-GENE-040822-22 | Length: | 318 | Species: | Danio rerio |
Alignment Length: | 270 | Identity: | 56/270 - (20%) |
---|---|---|---|
Similarity: | 92/270 - (34%) | Gaps: | 120/270 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 350 RC-DLSHSYERYWRKNRLCMNIGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQ 413
Fly 414 DAQVVVYHDFVLRFML------------------------------------QRMPSFEDLLE-- 440
Fly 441 -----------NQDLLIFAYENLNKLML------LAMGGSKRKDLIAVPLEAFSYDQLKEVKVLR 488
Fly 489 FAGSKGCDKSCDRMLLEQRPFPLLLDL-------------------LDEENLPVDMGFLI-EIKW 533
Fly 534 PQ-MTNMRRW 542 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3942 | NP_650171.2 | CBM20_Prei4 | 44..164 | CDD:99888 | |
GDPD_GDE5 | 368..684 | CDD:176549 | 51/251 (20%) | ||
GDPD | 372..685 | CDD:281062 | 50/247 (20%) | ||
gdpd1 | NP_001004118.1 | GDPD_GDE4 | 12..310 | CDD:176553 | 56/270 (21%) |
UgpQ | 41..307 | CDD:223657 | 51/249 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0584 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |