DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and gde1

DIOPT Version :9

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_956537.1 Gene:gde1 / 393213 ZFINID:ZDB-GENE-040426-881 Length:333 Species:Danio rerio


Alignment Length:347 Identity:71/347 - (20%)
Similarity:120/347 - (34%) Gaps:107/347 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 IGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVLRFMLQRMPS 434
            :.|:|.|:.       ..|||:...:.|....|..||:|::.|.|...::.||            
Zfish    70 VAHRGGGHD-------APENTIAAIRAASENGATGVELDLEFTADGVPILMHD------------ 115

  Fly   435 FEDLLENQDLLIFAYENLNKLMLLAMGGSKRKDLIAVPLEAFSYDQLKEVKVLRFAGSKGCDKSC 499
                 |..|........||||:.     |:.:.|.|.....||.         ||.|.|      
Zfish   116 -----ETVDRTTNGSGPLNKLLF-----SELRKLDAAAKHRFSD---------RFRGEK------ 155

  Fly   500 DRMLLEQRPFPLLLDLLDEENLPVDMGFLIEIK-WPQMTNMRRWESGSFKPTFDRNFYVDTILEI 563
                     .|.|.:.: ||.:...:....::| .|...      :.:.|..|.:       ..:
Zfish   156 ---------VPTLQEAV-EECIKHQLTIYFDVKGHPDEA------AAALKELFRK-------YPV 197

  Fly   564 VLNKAGKRRIVFCSFDADICAMVRFKQ---NVYPVTLLLEDPHSPVQYADQRVSVQDVAVRFCNS 625
            :.|.:     :.|||:..:  :.|.:|   ||  ||.|...|.|..::.|.       ..||.::
Zfish   198 LYNTS-----IVCSFEPKV--IYRMRQADPNV--VTALTHRPWSLSRFGDG-------TPRFSST 246

  Fly   626 -----LEFLGLTL---HANSLLNKPSTMAYLHQINL---DAFVY----GSSTIDLEIRNKLKKHG 675
                 ::.|.:.|   |.:.|.|.....|:|.|.|.   |...|    |...:...:...::|. 
Zfish   247 WKQHWMQVLDVLLDWAHHHLLWNLCGVSAFLVQKNFISPDYVQYWAARGVEVVGWTVNTAVEKQ- 310

  Fly   676 VLGIIYDRLDQLDQVGEELEGD 697
                .|.:|.:::.:.:.|..|
Zfish   311 ----YYQQLLKINYITDSLVED 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 68/332 (20%)
GDPD 372..685 CDD:281062 68/331 (21%)
gde1NP_956537.1 GDPD_GDE1 70..325 CDD:176515 69/342 (20%)
GDPD 72..323 CDD:281062 69/338 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.