DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and Gdpd2

DIOPT Version :9

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001100414.1 Gene:Gdpd2 / 302421 RGDID:1560780 Length:538 Species:Rattus norvegicus


Alignment Length:390 Identity:76/390 - (19%)
Similarity:128/390 - (32%) Gaps:171/390 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 IGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVLRFMLQRMPS 434
            :||:|:       ..:..||||...::.....|.:.|.||.::.|....:.||            
  Rat   227 VGHRGA-------PMLAPENTLMSLRKTAECGAAVFETDVMVSSDGVPFLMHD------------ 272

  Fly   435 FEDLLENQDLLIFAYENLNKLMLLAMGGSKRKDLIAVPLEAFSYDQLKEVKVLRFAGSKGCDKSC 499
                           |.|::...:|   |...:.|:.....||:.:|:::.    ||:       
  Rat   273 ---------------ERLSRTTNVA---SVFPERISAHSSDFSWAELQKLN----AGT------- 308

  Fly   500 DRMLLEQRPF-------------------PLLLDLLDEE---NLPVDMGFLIEIKWPQMTNMRRW 542
              ..||:|||                   |.|.::|.|.   ||.|            |.::|| 
  Rat   309 --WFLERRPFWGAKKLSGSDQKEAGNQTVPALEEVLKEAATLNLSV------------MFDLRR- 358

  Fly   543 ESGSFKPTFDRNFY---VDTILEIVLNKAGKRRIVFCSFDADICAMVRFKQNVYPVTLLLEDPHS 604
                  |..:..:|   |:..:|.||:.:..:.:|                      |.|.|   
  Rat   359 ------PPRNHTYYDTFVNQTVEAVLSASVPQAMV----------------------LWLPD--- 392

  Fly   605 PVQYADQRVSVQDVAVRF--------CNSLE---FLGLTLHANSLLNKPSTMAYLHQINLDAFVY 658
                 :.|.:||..|.|.        .|..|   ||.|......:|:    :..|||.|:     
  Rat   393 -----EDRATVQQRAPRMRQIYGYRGSNGTERPQFLNLPYQDLPVLD----IKALHQDNV----- 443

  Fly   659 GSSTIDLEIRNKLKKHGVLGIIYDRLDQLDQVGEELEGDTMCT-IDSVTTR--RVIQETEVEEWI 720
               :::|.:.||.....:|                     .|. :|||||.  :::|:.:...|:
  Rat   444 ---SVNLFVVNKPWLFSLL---------------------WCAGVDSVTTNDCQLLQQMQYPLWL 484

  Fly   721  720
              Rat   485  484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 68/349 (19%)
GDPD 372..685 CDD:281062 67/348 (19%)
Gdpd2NP_001100414.1 PI-PLCc_GDPD_SF 198..499 CDD:417475 76/390 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.