DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and Gdpd5

DIOPT Version :9

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001349096.1 Gene:Gdpd5 / 233552 MGIID:2686926 Length:612 Species:Mus musculus


Alignment Length:161 Identity:31/161 - (19%)
Similarity:55/161 - (34%) Gaps:67/161 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 IGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVLR-------- 426
            |||:|:       ..:..|:|:..|::|:......::.|:.::.|....:.||..||        
Mouse   231 IGHRGA-------PMLAPEHTVMSFRKALEQRLYGLQADITISLDGVPFLMHDTTLRRTTNVEHL 288

  Fly   427 --------------FMLQRM-------------------PSFEDLLENQDLLIFAYENLNKLMLL 458
                          .:|||:                   ||....::||.:.     :|.:|:.|
Mouse   289 FPELARRPAAMLNWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREVQNQSIC-----SLAELLEL 348

  Fly   459 AMGGSK--------------RKDLIAVPLEA 475
            |.|.:.              |...:.|.|||
Mouse   349 AKGNASLLLNLRDPPRDHPYRGSFLNVTLEA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 31/161 (19%)
GDPD 372..685 CDD:281062 29/159 (18%)
Gdpd5NP_001349096.1 PI-PLCc_GDPD_SF 227..581 CDD:387364 31/161 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..612
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.