DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3942 and T09B9.3

DIOPT Version :9

Sequence 1:	NP_650171.2	Gene:	CG3942 / 41489	FlyBaseID:	FBgn0038008	Length:	739	Species:	Drosophila melanogaster
Sequence 2:	NP_509638.2	Gene:	T09B9.3 / 188321	WormBaseID:	WBGene00011644	Length:	340	Species:	Caenorhabditis elegans

Alignment Length:	163	Identity:	38/163 - (23%)
Similarity:	59/163 - (36%)	Gaps:	71/163 - (43%)

- Green bases have known domain annotations that are detailed below.

  Fly   386 VRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVY------------------------------ 420
            |.:||:..|:||....||.:.|||::|:|..::|.
Worm    78 VHKNTIPAFRQAKQNGADTIVMDVRMTKDGMLIVLLPDSVDTDNATYIVDETHWIQMSQLNVYGG 142

  Fly   421 -HDFVLRF-------------MLQRMPSFEDLLENQDLLIFAYENLNKLMLLAMGGSKRKDLIAV 471
             :..:|.|             |:..:|||     :.|||.:.   .||:|..::     .|.:||
Worm   143 NNGTILTFDEAVSWCEANKMNMIWHIPSF-----SSDLLTYL---RNKIMQDSL-----YDKVAV 194

  Fly   472 PLEAFSYDQLKEVKVLRFAGSKGCDKSCDRMLL 504
            .    :|:       |..||...|   .||.||
Worm   195 T----TYN-------LIAAGRIRC---TDRQLL 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3942	NP_650171.2	CBM20_Prei4	44..164	CDD:99888
		GDPD_GDE5	368..684	CDD:176549	38/163 (23%)
		GDPD	372..685	CDD:281062	38/163 (23%)
T09B9.3	NP_509638.2	GDPD_GDE1	67..314	CDD:176515	38/163 (23%)
T09B9.3	NP_509638.2	GDPD	81..311	CDD:281062	37/160 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0584
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900