DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP4F2

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:511 Identity:133/511 - (26%)
Similarity:206/511 - (40%) Gaps:95/511 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVG-------VCFWIYFLWS------------RRRLYMMHFKIPGPMGLPILGIAFEYLITY 51
            |||.||       |..|.|..:.            ||..:..|..:..|.               
Human    21 LLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPT--------------- 70

  Fly    52 KRKMSIRTKYMDIYGSTCLVWVGP-TPFVITRDPKIAEEIF-LSPECLNRSSIFSKPVNSCTGDG 114
            :..|.:.|:.:..|.....||:|| :|.:....|.|...:. .|.....:...|...:....|||
Human    71 EEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDG 135

  Fly   115 LLSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRI 179
            ||.....||...|:.|.|||..|:|..::.|||.....:.|....|..:|...:  |:    |..
Human   136 LLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACL--DM----FEH 194

  Fly   180 ATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHNKI--------FSTLGG------ 230
            .:..|:.:..|...||.:....|..|....|:.::.|:...|::|        :.|..|      
Human   195 ISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRA 259

  Fly   231 ------------FETQKALAKSNVNKMIGT--------IVDKKLMTKPESGSQPEITSVINKAIE 275
                        .|.::.|....|:..:..        .:|..|::|.|.|.             
Human   260 CRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGK------------- 311

  Fly   276 LHRNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVT 340
                 ::|.|::::|..:|:....:||...:...|..||..||:|:...||::||.......|:.
Human   312 -----KLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIE 371

  Fly   341 YDDLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGT 405
            :|||..:.||...:.|:|||.|.||...|...:|..|..|.|||||:...|.:|.||.|...| .
Human   372 WDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVW-P 435

  Fly   406 DPSSFNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKV 461
            ||..::|..|.|:|:::|.|.|:||||.|.|||||..:.:...|:.|:..|...:|
Human   436 DPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 122/465 (26%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 8/35 (23%)
p450 52..515 CDD:365848 125/480 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.