DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and DIT2

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_010690.1 Gene:DIT2 / 852011 SGDID:S000002810 Length:489 Species:Saccharomyces cerevisiae


Alignment Length:528 Identity:114/528 - (21%)
Similarity:212/528 - (40%) Gaps:93/528 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTFQLLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLP-----------ILGIAFEYLITYKRK 54
            |:..:||     |..::...|    |:....|..|:..|           .|.:.|....|....
Yeast     1 MELLKLL-----CLILFLTLS----YVAFAIIVPPLNFPKNIPTIPFYVVFLPVIFPIDQTELYD 56

  Fly    55 MSIRTKYMDIYGSTCLVWVGPTPFVITRDPKIAEEIFLSPECL----NRSSIFSKPVNSCTGDGL 115
            :.|| :.|:.||:....:......:::|...:| :||...:..    |:..|....:.:.|||.:
Yeast    57 LYIR-ESMEKYGAVKFFFGSRWNILVSRSEYLA-QIFKDEDTFAKSGNQKKIPYSALAAYTGDNV 119

  Fly   116 LSLEASKWVDRRKNLNPAFKQNVLLSF--LPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFR 178
            :|...:.|.:.|..:.     |.|..|  .|||.: ||.|...:.:.:.:|:..:  .:...|.|
Yeast   120 ISAYGAVWRNYRNAVT-----NGLQHFDDAPIFKN-AKILCTLIKNRLLEGQTSI--PMGPLSQR 176

  Fly   179 IA----TQTTVGTDV-----KKDASFKNDSVLKS---YETFMKIIVMNVLLPFTHNKIFSTLGGF 231
            :|    :|..:|.|.     :|:|..::...:|.   :..|:....::||...:..|.|..:..|
Yeast   177 MALDNISQVALGFDFGALTHEKNAFHEHLIRIKKQIFHPFFLTFPFLDVLPIPSRKKAFKDVVSF 241

  Fly   232 ETQKALAKSNVNKMIGTIVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSREEVQSECCSFVV 296
              ::.|.|...::::...       |.|     :.|...:..|..|.|..:..:::.......:|
Yeast   242 --RELLVKRVQDELVNNY-------KFE-----QTTFAASDLIRAHNNEIIDYKQLTDNIVIILV 292

  Fly   297 AAFETTGDTVYHALILLAMFP-EHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRL 360
            |..|........:|.|||.:. |.|:.:.:|:..:....|        |..:..|...:.|.:|:
Yeast   293 AGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKG--------LADLPLLNAFLFEVVRM 349

  Fly   361 IPSV-PFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPD--NVRD 422
            .|.: ....|.|.:..:|.:.:||||||.:|.:.|.|..:...|||....|.|:.:..|  .:|.
Yeast   350 YPPLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERWGSDIETIRK 414

  Fly   423 -----RHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYED------------- 469
                 ::..|...|..|||.|:|.|..|...:::|:::|:..:.|....:|:             
Yeast   415 NWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFRWSLDPEWEEKLTPAGPLCPLNL 479

  Fly   470 -LEFVDNI 476
             |:|.:||
Yeast   480 KLKFNENI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 101/467 (22%)
DIT2NP_010690.1 CYP56-like 65..485 CDD:410693 97/450 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1605
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.