DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP721A1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_177649.1 Gene:CYP721A1 / 843850 AraportID:AT1G75130 Length:505 Species:Arabidopsis thaliana


Alignment Length:521 Identity:132/521 - (25%)
Similarity:222/521 - (42%) Gaps:81/521 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTFQLLLAVGVCFWIYF------LWSRRRLYMMHFK---IPGPMGLPILGIAFEY-LITYKRKM 55
            |..|.:|  |.|.|::.|      :|...|: ..|||   :.||......|.:.|. .:|.:.|.
plant     1 MAVFFIL--VLVFFFLVFRFIYSNIWVPWRI-QSHFKKQSVTGPSYRIFSGNSGEVSRLTAEAKS 62

  Fly    56 S--------------IRTKYMD---IYGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIF 103
            .              :...|.:   :||.|.|.|.|..|.|.|.||::..|...:....:|  |.
plant    63 KPIPSGRNPHEFVHRVAPHYHEWSRVYGKTFLYWFGSKPVVATSDPRLIREALTTGGSFDR--IG 125

  Fly   104 SKPVNSCT-GDGLLSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEK- 166
            ..|::... ..||..|...:|...|:....||....|..::|...:....|:...:.:...||: 
plant   126 HNPLSKLLYAQGLPGLRGDQWAFHRRIAKQAFTMEKLKRWVPQMVTSTMMLMEKWEDMRNGGEEI 190

  Fly   167 --KVRDDIVRWSFRIATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVM---NVLLP---FTHNK 223
              :|..::...|..:.::|..|..|:     :...:.:..|..|::..:   :|.:|   |..:|
plant   191 ELEVHKEMHNLSAEMLSRTAFGNSVE-----EGKGIFELQERMMRLFYLVRWSVYIPGFRFFPSK 250

  Fly   224 IFSTLGGFETQKALAKSNVNKMI---GTIVDKKLMTKPESGS--QPEITSVINKAIELHRNGEMS 283
            ....:...|.|   .:.::.|:|   .|.|:|       ||:  |..::...|      :||:..
plant   251 TNREIWRIEKQ---IRVSILKLIENNKTAVEK-------SGTLLQAFMSPYTN------QNGQEE 299

  Fly   284 R---EEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEV-TYDDL 344
            :   |||..||.:|..||.|||.:.:...|:||||..|.|:...:   |:..|.|...: |.|.|
plant   300 KLGIEEVTDECKTFYFAAKETTANLMTFVLVLLAMNQEWQNIARE---EVICVLGQTGLPTLDIL 361

  Fly   345 QRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSS 409
            |.:..|..::||||||.|......|:|::..:|.. :.||.|..:.:.:.|.|.:::.||.|...
plant   362 QDLKTLSMIINETLRLYPPAMTLNRDTLKRAKLGD-LDIPAGTQLYLSVVAMHHDKETWGDDAEE 425

  Fly   410 FNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILR--NCKVSTSFRYEDLEF 472
            |||..|....   :.....:||..|.|.|:|....:..:|..|:.||:  :.::|.|:.:..:.|
plant   426 FNPRRFEDPK---KQSALLVPFGLGPRTCVGQNLAVNEAKTVLATILKYYSFRLSPSYAHAPVLF 487

  Fly   473 V 473
            |
plant   488 V 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 116/468 (25%)
CYP721A1NP_177649.1 p450 26..495 CDD:386267 124/494 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.