powered by:
Protein Alignment Cyp313a3 and CYP721A1
DIOPT Version :10
| Sequence 1: | NP_650170.2 |
Gene: | Cyp313a3 / 41488 |
FlyBaseID: | FBgn0038007 |
Length: | 492 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_177649.1 |
Gene: | CYP721A1 / 843850 |
AraportID: | AT1G75130 |
Length: | 505 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 30 |
Identity: | 9/30 - (30%) |
| Similarity: | 10/30 - (33%) |
Gaps: | 16/30 - (53%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 RRNLQLI----------W------PALKVN 23
||.||:. | |.|.||
plant 144 RRRLQICNKLARKSFYSWQNPKSMPLLPVN 173
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Cyp313a3 | NP_650170.2 |
CYP313-like |
66..487 |
CDD:410680 |
|
| CYP721A1 | NP_177649.1 |
CYP734 |
79..497 |
CDD:410732 |
9/30 (30%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
