DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP735A2

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_176882.1 Gene:CYP735A2 / 843031 AraportID:AT1G67110 Length:512 Species:Arabidopsis thaliana


Alignment Length:525 Identity:125/525 - (23%)
Similarity:218/525 - (41%) Gaps:78/525 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAV---GVCFWIYFLWSRR-RLYMMHFKIPGPMGLPILG--IAFEYLITYKRKMSIRTKYMDI 64
            |:|.|   .:|  .|||..|| :.:|....|.||....:.|  |....::::.......:.:.:|
plant    17 LILRVLYDSIC--CYFLTPRRIKKFMERQGITGPKPRLLTGNIIDISKMLSHSASNDCSSIHHNI 79

  Fly    65 --------------YGSTCLVWVGPTP-FVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDG 114
                          ||...::|.|..| ..:|....|.|.:........:|.:..:......|.|
plant    80 VPRLLPHYVSWSKQYGKRFIMWNGTEPRLCLTETEMIKELLTKHNPVTGKSWLQQQGTKGFIGRG 144

  Fly   115 LLSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRI 179
            ||......|..:|....|||.::.|..:........|.:...|...||: |.::.:::.|.:..|
plant   145 LLMANGEAWHHQRHMAAPAFTRDRLKGYAKHMVECTKMMAERLRKEVGE-EVEIGEEMRRLTADI 208

  Fly   180 ATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVL---------------LPFTHNKIFSTLG 229
            .::|..|:           |..|..|.|..:.|:..|               ||..:|:...:| 
plant   209 ISRTEFGS-----------SCDKGKELFSLLTVLQRLCAQATRHLCFPGSRFLPSKYNREIKSL- 261

  Fly   230 GFETQKALAKSNVNKMIGTIVDKK---LMTKPESGSQPEITSVINKAIELHRNGEMSREEVQSEC 291
                     |:.|.:::..|:|.:   :.....|....::..::...::.::| .::.:.:..||
plant   262 ---------KTEVERLLMEIIDSRKDSVEIGRSSSYGDDLLGLLLNQMDSNKN-NLNVQMIMDEC 316

  Fly   292 CSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAG-DFEVTYDDLQRMVFLERVVN 355
            .:|.....|||...:...|:|||..|..||.|..|:::   |.| |...:.:.|..:..|.:|:|
plant   317 KTFFFTGHETTSLLLTWTLMLLAHNPTWQDNVRDEVRQ---VCGQDGVPSVEQLSSLTSLNKVIN 378

  Fly   356 ETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDN- 419
            |:|||.|.....||....|.:|.. ::||||:.|.|.:.|.|.:.:.||.|.:.|||:.|...: 
plant   379 ESLRLYPPATLLPRMAFEDIKLGD-LIIPKGLSIWIPVLAIHHSNELWGEDANEFNPERFTTRSF 442

  Fly   420 VRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFV-----DNIGME 479
            ...||   ::||:.|.|||||..:.:|.:|:.|:.::.....:.|..|.....|     ...|::
plant   443 ASSRH---FMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFAISENYRHAPIVVLTIKPKYGVQ 504

  Fly   480 LAQSP 484
            |...|
plant   505 LVLKP 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 108/466 (23%)
CYP735A2NP_176882.1 PLN02290 2..511 CDD:215164 125/525 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.