DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP72C1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:250 Identity:65/250 - (26%)
Similarity:101/250 - (40%) Gaps:69/250 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPV----NSCTGDGLLSLEASKWVD 125
            :|..|..|.||.|.||..||:...||      :::..:|.||.    |.....|||:.|..||..
plant    94 HGKKCFTWYGPYPNVIVMDPETLREI------MSKHELFPKPKIGSHNHVFLSGLLNHEGPKWSK 152

  Fly   126 RRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVGTDVK 190
            .|..|||||:.:.|.|.||.|||..|.::...:.|   ...|...::..|        |...|:.
plant   153 HRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERL---ASAKGTMELDSW--------THCHDLT 206

  Fly   191 KD----ASFKNDSVLKSYETFMKIIVMNVLLPFTHNKIFSTLGGFETQK------ALAKSNV--- 242
            ::    |||.:     ||:..:||                    ||.|:      .||...|   
plant   207 RNMLARASFGD-----SYKDGIKI--------------------FEIQQEQIDLGLLAIRAVYIP 246

  Fly   243 -NKMIGTIVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSR---EEVQSECCS 293
             :|.:.|..:::|..     ::.::.::....||. :..|:.|   .:..|:|||
plant   247 GSKFLPTKFNRRLRE-----TERDMRAMFKAMIET-KEEEIKRGRGTDKNSDCCS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 64/249 (26%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.