DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP94B1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001331365.1 Gene:CYP94B1 / 836464 AraportID:AT5G63450 Length:568 Species:Arabidopsis thaliana


Alignment Length:405 Identity:82/405 - (20%)
Similarity:160/405 - (39%) Gaps:37/405 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VITRDPKIAEEIFLSPECLNRSSIFS----KPVNSCTGD----GLLSLEASKWVDRRKNLNPAFK 135
            :||.:|:..|.|.       :::.::    ||.....||    |:.:.:...|..:||..:..|.
plant   142 IITANPENVEHIL-------KTNFYNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFT 199

  Fly   136 QNVLLSF-LPIFNSEAKT-LVAFLDSLVGQGEK-KVRDDIVRWSFRIATQTTVGTDVK-KDASFK 196
            ...|..| ..|...|.:. |:..|.|.|..||. ..::.:.|::|.:..:.::|.|.. .|.:..
plant   200 MRSLREFTFEILREEVQNRLIPVLSSAVDCGETVDFQEVLKRFAFDVVCKVSLGWDPDCLDLTRP 264

  Fly   197 NDSVLKSYETFMKIIVMNVLLP-FTHNKIFSTLG-GFETQKALAKSNVNKMIGTIVDKKLMTKPE 259
            ...::|:::...:|.......| :...|:...|. |.|.:...|...|:..:..|:..|..:...
plant   265 VPELVKAFDVAAEISARRATEPVYAVWKVKRFLNVGSEKRLREAIKTVHLSVSEIIRAKKKSLDI 329

  Fly   260 SGSQPEITSVINKAIELHRNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVY 324
            .|...:...::::.:......|..|:.|    .||::|..:||...:.....||:...:.:..:.
plant   330 GGDVSDKQDLLSRFLAAGHGEEAVRDSV----ISFIMAGRDTTSAAMTWLFWLLSQNDDVETKIL 390

  Fly   325 QELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGI 389
            .||:.    .|...:.::||:.|.:.:..:.|.:||.|.|.:..:....|..|..|..:.||..:
plant   391 DELRN----KGSLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDILPDGTPLKKGDKV 451

  Fly   390 GIDIFATHRNRDHWGTDPSSFNPDHFLPDN--------VRDRHPYAYIPFSKGRRNCIGWKYGLM 446
            ....:...|....||.|...|.|:.:..:.        ::....:.:..|..|.|.|||.:....
plant   452 TYFPYGMGRMEKVWGKDWDEFKPNRWFEEEPSYGTKPVLKSVSSFKFPVFQAGPRVCIGKEMAFT 516

  Fly   447 SSKLALSKILRNCKV 461
            ..|..:..:|...|:
plant   517 QMKYVVGSVLSRFKI 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 82/405 (20%)
CYP94B1NP_001331365.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.