DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP709B3

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:531 Identity:129/531 - (24%)
Similarity:211/531 - (39%) Gaps:102/531 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTFQLLLAVGVCFWIYFLWS-------RRRLYMMHFK---IPGPMGLPILGIAFEYLITYKRKM 55
            :.|..||..|.:.|.:..:|.       |..:....||   |.||          :|.|.|....
plant     4 ISTINLLTIVLLLFVVSKIWKACWILLLRPLMLSKRFKKQGISGP----------KYKILYGNLS 58

  Fly    56 SIRT--------------------------KYMDIYGSTCLVWVGPTPFVITRDPKIAEEIFLS- 93
            .|:.                          ::|..||.|.|.|.|..|.:...:.::|:::..| 
plant    59 EIKKMKKEADLCVLDPNSNDIFPRVFPQYHQWMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSK 123

  Fly    94 ------PECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNLNPAFKQNVLLSF--------LP 144
                  |  :.|..:|     ...|.||..::...|:..|:.|||||..:.|.:.        |.
plant   124 FGFTIIP--VKRPEVF-----ILFGKGLSFIQGDDWIRHRRILNPAFSMDRLKAMTQPMGDCTLR 181

  Fly   145 IFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVGTDVKKDASFKNDSVLKSYETFMK 209
            ||....|..        ..||..::.:|.: .|...|...:.|.....:..:...:.:|.....|
plant   182 IFEEWRKQR--------RNGEVLIKIEISK-EFHKLTADIIATTAFGSSYAEGIELCRSQTELEK 237

  Fly   210 IIV---MNVLLPFTHNKIFST-LGGFETQKALAKSNVNKMIGTIVDKKLMTKPES-GSQPEITSV 269
            ..:   .||.:|.|......| |..:|..|     .|...|..|:|.:|.:|.:: |...::..|
plant   238 YYISSLTNVFIPGTQYLPTPTNLKLWELHK-----KVKNSIKRIIDSRLKSKCKTYGYGDDLLGV 297

  Fly   270 I---NKAIELHRNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELF 331
            :   .|:.|..|  :|..:|:..||.:|..|...||...:....:||::   ||....:..:|:|
plant   298 MLTAAKSNEYER--KMRMDEIIEECKNFYYAGQGTTSILLTWTTMLLSL---HQGWQEKLREEVF 357

  Fly   332 PVAGDFEV-TYDDLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFA 395
            ...|..:: ..|...::..:..|:.|:|||...|....||..:|.::.. :.||||..|.|.:..
plant   358 NECGKDKIPDTDTFSKLKLMNMVLMESLRLYGPVIKISREATQDMKVGH-LEIPKGTSIIIPLLK 421

  Fly   396 THRNRDHWGTDPSSFNPDHFLPDNVRDR---HPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILR 457
            .||::..||.|...|||..|  :|...:   ||.|.:|||.|.|.||...:.::.:|..|:.||:
plant   422 MHRDKAIWGEDAEQFNPLRF--ENGISQATIHPNALLPFSIGPRACIAKNFAMVEAKTVLTMILQ 484

  Fly   458 NCKVSTSFRYE 468
            ..::|.|..|:
plant   485 QFQLSLSPEYK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 116/482 (24%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 128/526 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.