DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and CYP4F12

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:523 Identity:140/523 - (26%)
Similarity:214/523 - (40%) Gaps:114/523 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVG------VCFWIYFLWSR-RRLYMMHFKIP-------GPMGLPILGIAFEYLITYKRKMS 56
            |||.||      :..|.|..::. |||..  |..|       |.:||         :...:..:.
Human    22 LLLVVGSWLLARILAWTYAFYNNCRRLQC--FPQPPKRNWFWGHLGL---------ITPTEEGLK 75

  Fly    57 IRTKYMDIYGSTCLVWVGP-TPFVITRDPKIAEEIF-LSPECLNRSSIFSKPVNSCTGDGLLSLE 119
            ..|:....|.....||:|| .||::...|.....|. .|.....:.::|.:.:....|:|:|...
Human    76 NSTQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSG 140

  Fly   120 ASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKV----------RDDIVR 174
            ..||...|:.|.|||..|:|.|::.|||..|..::.....|..:|..::          .|.:.:
Human   141 GDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSRLDMFEHISLMTLDSLQK 205

  Fly   175 WSFR------------IATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHN----- 222
            ..|.            |||...:...|:|    ::..:|:.         |:.|...:|:     
Human   206 CIFSFDSHCQERPSEYIATILELSALVEK----RSQHILQH---------MDFLYYLSHDGRRFH 257

  Fly   223 ------------------KIFSTLGGFETQKALAKSNVNKMIGTIVDKKLMTKPESGSQPEITSV 269
                              :...|.|..:..|..|||.....|    |..|::|.|.|        
Human   258 RACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFI----DVLLLSKDEDG-------- 310

  Fly   270 INKAIELHRNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVA 334
              ||        :|.|::::|..:|:....:||...:...|..||..||:|:...||::||....
Human   311 --KA--------LSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDR 365

  Fly   335 GDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRN 399
            ...|:.:|||.::.||...|.|:|||.|..||..|...:|..|..|.|||||:...|||...|.|
Human   366 DPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHN 430

  Fly   400 RDHWGTDPSSFNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTS 464
            ...| .||..::|..|.|:|.:.|.|.|:||||.|.|||||..:.:...|:.|:.:|.:      
Human   431 PTVW-PDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLH------ 488

  Fly   465 FRY 467
            ||:
Human   489 FRF 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 127/483 (26%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 129/491 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.