DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4f14

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001191262.1 Gene:Cyp4f14 / 64385 MGIID:1927669 Length:524 Species:Mus musculus


Alignment Length:424 Identity:124/424 - (29%)
Similarity:196/424 - (46%) Gaps:41/424 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TKYMDIYGSTCLVWVGP-TPFVITRDPKIAEEIFLSPECLNRSS-------IFSKPVNSCTGDGL 115
            |:.:..|....|:|:|| .|.:......|...|      ||.|:       ||...:....||||
Mouse    78 TRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSI------LNASAAVALKDVIFYSILKPWLGDGL 136

  Fly   116 LSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIA 180
            |.....||...|:.|.|||..|:|..::.|||.....:.|....|:..|..::  |:    |...
Mouse   137 LVSAGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQRLISDGSARL--DM----FEHV 195

  Fly   181 TQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHNK--IFSTL------GGFETQKAL 237
            :..|:.:..|...||.::...||.|....|:.::.|:...|.:  :|..|      .|...:||.
Mouse   196 SLMTLDSLQKCVFSFDSNCQEKSSEYIAAILELSALVAKRHQQPLMFMDLLYNLTPDGMRFRKAC 260

  Fly   238 AKSNVNKMIGTIVDKKLMTKPESGSQPEITS-VINKAIEL--------HRNG-EMSREEVQSECC 292
              :.|::....::.::..|.|:.|....:.| ..:|.::.        ..:| |:|.|::::|..
Mouse   261 --NVVHEFTDAVIRERHRTLPDQGLDDFLKSKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEAD 323

  Fly   293 SFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNET 357
            :|:....:||...:...|..||..||:|:...||::||.......|:.:|||.::.||...:.|:
Mouse   324 TFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVQELLRGREPEEIEWDDLAQLPFLTMCIKES 388

  Fly   358 LRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVRD 422
            |||.|.|....|...:|..|..|..||||:...|.||..|.|...| .||..::|..|.|:|::|
Mouse   389 LRLHPPVTVISRCCTQDILLPDGRTIPKGIICLISIFGIHHNPSVW-PDPEVYDPFRFDPENIKD 452

  Fly   423 RHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKIL 456
            ..|.|:||||.|.|||||..:.:...|:||:..|
Mouse   453 SSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 124/424 (29%)
Cyp4f14NP_001191262.1 p450 52..511 CDD:365848 124/424 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.