DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4a1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_787031.1 Gene:Cyp4a1 / 50549 RGDID:68945 Length:509 Species:Rattus norvegicus


Alignment Length:492 Identity:122/492 - (24%)
Similarity:201/492 - (40%) Gaps:87/492 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDIYGSTCL 70
            |||...|.|::...|    |.....:.|.|        .|.:...:|:....:.....:   ||:
  Rat    29 LLLVKAVQFYLQRQW----LLKAFQQFPSP--------PFHWFFGHKQFQGDKELQQIM---TCV 78

  Fly    71 ----------VWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSC----TGDGLLSLEAS 121
                      .| |...::|..||...:.|      |.||...:..|...    .|.|||.|...
  Rat    79 ENFPSAFPRWFW-GSKAYLIVYDPDYMKVI------LGRSDPKANGVYRLLAPWIGYGLLLLNGQ 136

  Fly   122 KWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVG 186
            .|...|:.|.|||..::|..::.......:.::...:.|.||      |..:. .|:..:..|:.
  Rat   137 PWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLDKWEQLAGQ------DSSIE-IFQHISLMTLD 194

  Fly   187 TDVKKDASFKNDSVL--KSYETFMKII----------VMNVLLPFTHNKI---FSTLGG-FETQK 235
            | |.|.|...|.||.  .:|:::::.|          |.|:   |..|..   ||:.|. |....
  Rat   195 T-VMKCAFSHNGSVQVDGNYKSYIQAIGNLNDLFHSRVRNI---FHQNDTIYNFSSNGHLFNRAC 255

  Fly   236 ALAKSNVNKMIGTIVDKKLMTKPESGSQPEITSVINK---------AIELHRNGE-MSREEVQSE 290
            .||..:.:.:|       .:.|.:..:..|:..|..|         .:....||: :|.:::::|
  Rat   256 QLAHDHTDGVI-------KLRKDQLQNAGELEKVKKKRRLDFLDILLLARMENGDSLSDKDLRAE 313

  Fly   291 CCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGD-FEVTYDDLQRMVFLERVV 354
            ..:|:....:||...|......||..||||....:|::.   |.|| ..:|:|.|.::.:....:
  Rat   314 VDTFMFEGHDTTASGVSWIFYALATHPEHQQRCREEVQS---VLGDGSSITWDHLDQIPYTTMCI 375

  Fly   355 NETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDN 419
            .|.|||.|.||...||.........|..:|||:.:.:.|:..|.|...| .:|..|:|..|.||:
  Rat   376 KEALRLYPPVPGIVRELSTSVTFPDGRSLPKGIQVTLSIYGLHHNPKVW-PNPEVFDPSRFAPDS 439

  Fly   420 VRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKIL 456
              .||.::::|||.|.|||||.::.:...|:.::..|
  Rat   440 --PRHSHSFLPFSGGARNCIGKQFAMSEMKVIVALTL 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 115/465 (25%)
Cyp4a1NP_787031.1 p450 52..503 CDD:278495 115/465 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.