DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4d14

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster


Alignment Length:493 Identity:138/493 - (27%)
Similarity:232/493 - (47%) Gaps:53/493 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTFQLLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLI--TYKRKMSI---RTK 60
            ::.|.:|||..:. |.|....|.........|.||...|::|.| ..||  :.|.|.||   :.:
  Fly     3 LELFAILLATALA-WDYMRKRRHNKMYAEAGIRGPKSYPLVGNA-PLLINESPKSKSSIFDMQFR 65

  Fly    61 YMDIYGSTCLV-WVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWV 124
            .:..:|..... .:|.:.| :|.|.|:.|.|..|.:.:.:::::|..|| ..|||||..:..||.
  Fly    66 LIAEFGKNIKTQMLGESGF-MTADSKMIEAIMSSQQTIQKNNLYSLLVN-WLGDGLLISQGKKWF 128

  Fly   125 DRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFL-DSLVGQGEKKVRDDIVRWSFRIATQTTVGTD 188
            .|||.:.|||...:|..|:.:|:.::.|:|..| |...|:....:.......:..|..:|.:|  
  Fly   129 RRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDRADGKTVINMFPVACLCAMDIIAETAMG-- 191

  Fly   189 VKKDASFKND-SVLKSYETFMKIIV---MNVL--LPFT----HNKIFSTLGGFETQKALAKSNVN 243
            ||.:|..:.. :.::|..|...::.   ||.|  |.||    :.|:...|..       |..|::
  Fly   192 VKINAQLQPQFTYVQSVTTASAMLAERFMNPLQRLDFTMKLFYPKLLDKLND-------AVKNMH 249

  Fly   244 KMIGTIVD--KKLMTKPESGSQPEITSVINKAIELHR-------------NGEMSREEVQSECCS 293
            ....:::.  ::|:.|..:.......:::|...:..|             ...:|.::::.|..:
  Fly   250 DFTNSVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTIDGAPLSNDDIREEVDT 314

  Fly   294 FVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFE---VTYDDLQRMVFLERVVN 355
            |:....:||..::.....|||..||.|..|:||:::   |.||.:   ||...|..:.:||.|:.
  Fly   315 FMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRD---VIGDDKSAPVTMKLLGELKYLECVIK 376

  Fly   356 ETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNV 420
            |:|||.||||...|...:|..| .|.:||....:.|.|:...|:.|:: .||..|.||.|..:..
  Fly   377 ESLRLFPSVPIIGRYISQDTVL-DGKLIPADSNVIILIYHAQRDPDYF-PDPEKFIPDRFSMERK 439

  Fly   421 RDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRN 458
            .:..|:||.|||.|.|||||.|:.::..|..:||::|:
  Fly   440 GEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRH 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 130/461 (28%)
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 130/461 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.