DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4e1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster


Alignment Length:519 Identity:138/519 - (26%)
Similarity:234/519 - (45%) Gaps:66/519 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAVGVCFWIYF-LWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDIYG-STCL 70
            ||:.:....|| |...||..|:: |..||..||::|.|.:...|....::....:...|| ....
  Fly     9 LALPLFLVTYFELGLLRRKRMLN-KFQGPSMLPLVGNAHQMGNTPTEILNRFFGWWHEYGKDNFR 72

  Fly    71 VWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNLNPAFK 135
            .|:|....::..:||..|.|..|...:::|.::.. .:...|.|||:...|||...||.:.|||.
  Fly    73 YWIGYYSNIMVTNPKYMEFILSSQTLISKSDVYDL-THPWLGLGLLTSTGSKWHKHRKMITPAFH 136

  Fly   136 QNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFR---------IATQTTVGTDVKK 191
            .|:|..|..:.|..:   ..|:|.|     |||.|....:.|:         :...|.:|..:..
  Fly   137 FNILQDFHEVMNENS---TKFIDQL-----KKVADGGNIFDFQEEAHYLTLDVICDTAMGVSINA 193

  Fly   192 DASFKNDSVLKSYETFMKIIVMNVLLPFTHNK-IFSTLGGF-ETQKALAKSNVNKMIGTIVDKKL 254
            ..: ::.||:::::.....|.|....|:..|| :|.....: |..|.|  ..:......|:.|::
  Fly   194 MEN-RSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTL--KTLQDFTNEIIAKRI 255

  Fly   255 MTKPESGSQPEITSVINKAIELHR--------------NGE-MSREEVQSECCSFVVAAFETTGD 304
            ..: :||.:..|     ||.|..|              :|. ::.:|:..|..:|:....:||..
  Fly   256 EVR-KSGLEVGI-----KADEFSRKKMAFLDTLLSSKVDGRPLTSQELYEEVSTFMFEGHDTTTS 314

  Fly   305 TVYHALILLAMFPEHQDTVYQELKELFPVAG-DFEVTYDDLQRMVFLERVVNETLRLIPSVPFTP 368
            .|..|:.||:..|:.|:.::.|..::...:| ..:.|:.::..|..|:..:.|..||.|||||..
  Fly   315 GVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIG 379

  Fly   369 RETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVRDRH---PYAYIP 430
            |.|.:|: :..|.::|||..:.:.:.....| |....||..|.|:.|      ||.   |:.|:|
  Fly   380 RFTEKDY-VIDGDIVPKGTTLNLGLLMLGYN-DRVFKDPHKFQPERF------DREKPGPFEYVP 436

  Fly   431 FSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVD-----NIGMELAQSPGLEFH 489
            ||.|.|||||.|:.|:..|..:|||:||.:|..:.  ::|...|     .:|::.|:....:.|
  Fly   437 FSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPAL--DELVSKDGYISTTLGLQPAEKKSRDAH 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 124/460 (27%)
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 124/460 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.