DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:511 Identity:143/511 - (27%)
Similarity:237/511 - (46%) Gaps:43/511 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDIYGSTC-- 69
            ||...:.|.:.:...|.||.....|||||..:|.||.|.|..:.:....:.......::|:..  
  Fly    33 LLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVIGMQKLWGTRIGI 97

  Fly    70 -LVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNLNPA 133
             .||.|..|.|:..:|:..|.|..|.:.:|:|..:.. ::...|:|||:....||..|||.|.||
  Fly    98 NRVWQGTAPRVLLFEPETVEPILNSQKFVNKSHDYDY-LHPWLGEGLLTSTDRKWHSRRKILTPA 161

  Fly   134 FKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVGTDVKKDASFKND 198
            |...:|..|:.:||.::..|...|...||.....:...:...:..|..:|.:|..:...::.:::
  Fly   162 FHFKILDDFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQSNSESE 226

  Fly   199 ---------SVLKSYETFMKI-IVMNVLLPFT-----HNKIFSTLGGF--------ETQKALAKS 240
                     |:::|.:.  || :..:.:...|     |....:||.||        :.:.|:.:.
  Fly   227 YVKAVYGIGSIVQSRQA--KIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQE 289

  Fly   241 NVNKMIGTIVDKKLMTKPESGSQPEITSVINKAIELHRNGE-MSREEVQSECCSFVVAAFETTGD 304
            |.|.......|    ...:.|.:..: :.::..|:..:.|. :|.|:::.|..:|:....:||..
  Fly   290 NNNNNNNNAPD----AYDDVGKKKRL-AFLDLLIDASKEGTVLSNEDIREEVDTFMFEGHDTTSA 349

  Fly   305 TVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPR 369
            .:...|.||...||:|:.|.:||..:|....:...|..:|..|.:||..:.::|||.||||...|
  Fly   350 AISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMAR 414

  Fly   370 ETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYIPFSKG 434
            ....|..: .|.::|.|....|..:|.|||...: ..|..||||:|||:|...|||:||||||.|
  Fly   415 MVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVF-PKPEQFNPDNFLPENCAGRHPFAYIPFSAG 477

  Fly   435 RRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDNI------GMELAQSP 484
            .|||||.|:.::..|..:|.:||..|:....|.|||..:..:      |:.:..:|
  Fly   478 PRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITP 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 129/456 (28%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 134/481 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.