DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp316a1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster


Alignment Length:529 Identity:109/529 - (20%)
Similarity:206/529 - (38%) Gaps:117/529 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGVCFWI-----YFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLIT-----YKRKMSIRTK 60
            :|.|..:||.:     ||...|:|..:.:.|  ||...|::|...:.|..     ::|.    |:
  Fly     2 ILTATFICFCLASAFNYFRARRQRSLIKNLK--GPFTWPLMGAMHKLLFLTPINFFQRS----TE 60

  Fly    61 YMDIYGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTG---------DGLL 116
            |:..||:....||....|:...|.:::.::..:...|.            ||         .|:|
  Fly    61 YLTKYGTFSRCWVFHRLFIPLADLELSRQLLENDTHLE------------TGYELMKDWLVGGVL 113

  Fly   117 SLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRD------DIVRW 175
            ..::.:|..|...::..|.:..|...:.:...:.:.|   |..|..|.::||.|      .||  
  Fly   114 MCQSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQL---LQKLAKQADQKVFDIWYTVSPIV-- 173

  Fly   176 SFRIATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHNKIFSTLG-----GFETQK 235
             ..:...||.|....::.| ||   ||.             |...:.|.|.:|.     .:....
  Fly   174 -LDLMVMTTCGAKPSEEYS-KN---LKD-------------LSEIYRKRFLSLQSANRFNYWLSS 220

  Fly   236 ALAKSNVNKMIGTIVDK--KLMTKPESGSQPEITSVIN-------------KAIEL---HRNGEM 282
            ...:...|::|..:.|:  .||...:|.:|.:|.:.::             ..:|:   .::.::
  Fly   221 PFMRKRQNRLIKRLNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLESKDPQL 285

  Fly   283 SREEVQSE--CCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQ 345
            :.||:..|  .|:::  .::.....:...|:.:|..|..|.....||.     ....:....||:
  Fly   286 TGEEICGELNTCNYL--GYQLCSPALCFCLVTIARNPSVQQKCLDELN-----LAQIKDQGWDLE 343

  Fly   346 RMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVV----IPKGVGIGIDIFATHRNRDHWGTD 406
            ::.:|:.|::||:||.|......|:..:||..:..:|    :|.|..|.|:::...||...: ..
  Fly   344 KLNYLDAVLHETMRLYPPQVIVGRQLKKDFPYTHSIVGDAELPCGSEIYINLYELQRNEVRY-PK 407

  Fly   407 PSSFNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLE 471
            .:.|:...||..      |...:.:|.|.|.|...|:.:...|..|:.||.|        :|.|.
  Fly   408 ANHFDAQRFLDS------PPELLSYSLGPRCCPARKFSMQLLKTLLAPILAN--------FEVLP 458

  Fly   472 FVDNIGMEL 480
            :.|.:.::|
  Fly   459 YGDEVRLDL 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 96/478 (20%)
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 99/493 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.