DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp301a1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_610796.1 Gene:Cyp301a1 / 36378 FlyBaseID:FBgn0033753 Length:553 Species:Drosophila melanogaster


Alignment Length:497 Identity:112/497 - (22%)
Similarity:206/497 - (41%) Gaps:91/497 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KIPGPMGLPILG-------IAFEYLITYKRKMS--IRTKY---------------MDIYGS---- 67
            :||||..:||||       |..:|.|:...|:|  :..:|               :.||.:    
  Fly    74 QIPGPKPIPILGNTWRLMPIIGQYTISDVAKISSLLHDRYGRIVRFGGLIGRPDLLFIYDADEIE 138

  Fly    68 TCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNL-N 131
            .|....|||||    .|.:       |..:...|:..|......| |::.:....|.:.|..: .
  Fly   139 KCYRSEGPTPF----RPSM-------PSLVKYKSVVRKDFFGDLG-GVVGVHGEPWREFRSRVQK 191

  Fly   132 PAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRD---DIVRWSF----RIATQTTVGTDV 189
            |..:.:.:..:|.......:..:...::|:.:.::...|   :|.:||.    |:|..|.:|.  
  Fly   192 PVLQLSTIRRYLQPLEVITEDFLVRCENLLDENQELPEDFDNEIHKWSLECIGRVALDTRLGC-- 254

  Fly   190 KKDASFKNDSVLKSYETFMKIIVMNVL---LPFTHNKIFSTLGGFETQKALAKSNVNKMIGTIV- 250
             .:::.|.||..:......|..:.||.   |...:.:.|.|.......|     |:|..:|..: 
  Fly   255 -LESNLKPDSEPQQIIDAAKYALRNVATLELKAPYWRYFPTPLWTRYVK-----NMNFFVGVCMK 313

  Fly   251 -----DKKLMTKPES--GSQPEITSVINKAIELHRNGEMSREEVQS-ECCSFVVAAFETTGDTVY 307
                 .::|.|:..|  ..:|   |::.|.|...::     |::.: .....::...:|....|.
  Fly   314 YIQSATERLKTQDPSLRAGEP---SLVEKVILSQKD-----EKIATIMALDLILVGIDTISMAVC 370

  Fly   308 HALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPRETI 372
            ..|..||..|..|..|::|||.|.| ..:..:|...|.:|..|:..:.|..|:..:|....| |:
  Fly   371 SMLYQLATRPVDQQKVHEELKRLLP-DPNTPLTIPLLDQMHHLKGFIKEVFRMYSTVIGNGR-TL 433

  Fly   373 RDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFL-------PDNVRDRHPYAYIP 430
            .:..:..|..:||||........| .|.:.:.||.::|.|:.:|       |..:   ||:|.:|
  Fly   434 MEDSVICGYQVPKGVQAVFPTIVT-GNMEEYVTDAATFRPERWLKPQHGGTPGKL---HPFASLP 494

  Fly   431 FSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEF 472
            :..|.|.|:|.::..:..::.|:|:|||.|:  .:.::.|::
  Fly   495 YGYGARMCLGRRFADLEMQILLAKLLRNYKL--EYNHKPLDY 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 110/484 (23%)
Cyp301a1NP_610796.1 p450 76..530 CDD:299894 110/489 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.