DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_006240610.1 Gene:Cyp46a1 / 362782 RGDID:1306605 Length:500 Species:Rattus norvegicus


Alignment Length:481 Identity:117/481 - (24%)
Similarity:214/481 - (44%) Gaps:65/481 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDI------ 64
            :|||.|:|  ..|:...|..|.   .||||.....|.....|.  :|:..:......|:      
  Rat    12 VLLAFGLC--CTFVHRARSRYE---HIPGPPRPSFLLGHLPYF--WKKDEACGRVLQDVFLDWAK 69

  Fly    65 -YGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGD-----GLLS-LEASK 122
             ||....|.|.....||...|:..::..:|.: .|:.|...:.:.:..|:     ||:| .:..:
  Rat    70 KYGPVVRVNVFHKTSVIVTSPESVKKFLMSTK-YNKDSKMYRAIQTVFGERLFGQGLVSECDYGR 133

  Fly   123 WVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLV-GQGEKKVRDDIVRWSFRIATQTTVG 186
            |..:|:.::.||.::.|:|.:..||.:|:.|:..|::.. ||....::|        :.|..|: 
  Rat   134 WYKQRRVMDLAFSRSSLVSLMGTFNEKAEQLMEILEAKADGQTPVSMQD--------MLTCATI- 189

  Fly   187 TDVKKDASFKNDSVL-----KSYETFMKIIVMNVLLPFTHNKIFSTLGGFETQKALAKSNVN--K 244
             |:...|:|..::.:     |.....:|:::..:  ..:.|.:...:.|...|....:.::.  :
  Rat   190 -DILAKAAFGMETSMLLGAQKPLSQAVKVMLEGI--SASRNTLAKFMPGKRKQLREIRESIRLLR 251

  Fly   245 MIGT--IVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSREEVQSECCSFVVAAFETTGDTVY 307
            .:|.  :..::...|.......:|.:.|.||.|    |....|.:.....:|.:|..||:.:.:.
  Rat   252 QVGKDWVQRRREALKRGEDVPADILTQILKAEE----GAQDDEVLLDNFVTFFIAGHETSANHLA 312

  Fly   308 HALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPR--- 369
            ..::.|:..||....:..|:.|:  |.....:.|:||.|:.:|.:|:.|:|||.|....|.|   
  Rat   313 FTVMELSRQPEIVARLQAEVDEV--VGSKRHLDYEDLGRLQYLSQVLKESLRLYPPAWGTFRLLE 375

  Fly   370 -ETIRDFRLSSGVVIPKGVGIGIDIFATH--RNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYIPF 431
             ||:.|     ||.:|....:   :|:|:  ...|.:..||.:||||.|.|...:.|  :.|.||
  Rat   376 EETLID-----GVRVPGNTPL---LFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPR--FTYFPF 430

  Fly   432 SKGRRNCIGWKYGLMSSKLALSKILR 457
            |.|.|:|||.::..|..|:.::|:|:
  Rat   431 SLGHRSCIGQQFAQMEVKVVMAKLLQ 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 108/454 (24%)
Cyp46a1XP_006240610.1 p450 34..466 CDD:278495 108/454 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.