DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4p3

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster


Alignment Length:406 Identity:113/406 - (27%)
Similarity:201/406 - (49%) Gaps:46/406 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNLNPAFKQNVLLSFLPIFN 147
            |...||.:...|..:|:.:|:.. ::.....|||:....||..|||.|:|.|..|:|..|..||.
  Fly    98 DADSAERVLNDPNLINKGTIYDF-LHPFLRTGLLTSTGKKWHARRKMLSPTFHFNILNQFQEIFI 161

  Fly   148 SEAKTLVAFLDSLVGQGEK--KVRDDIVRWSFRIATQTTVGTDVKKDASFKNDSVLKSY----ET 206
            :|:   :.||:...|..|.  .:.:.|.|::.....:|.:|..:.:.|. |.|...:::    |.
  Fly   162 TES---LKFLEQFKGNDEAIISLNEVIPRFTLNSICETAMGVKLDEMAE-KGDRYRENFRQIEEC 222

  Fly   207 FMKIIVMNVLLPFTHNKIFS---------TLGGFETQKALAKSNVNKMIGTIVDKKLMT---KPE 259
            |::.:...:|...|..|:|:         .:.||.:: .:||.  ...:...:|.:..|   :.|
  Fly   223 FIRRMSNPLLWSDTLFKMFAEKDYASALDVVHGFSSE-IIAKR--RDQLNDEIDSRGNTQTAEDE 284

  Fly   260 SGSQPEITSVINKAIELHRNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVY 324
            ..:..:..::::..|...::|.:....:..|..:.:...::||...:...|:.::::||.|:..|
  Fly   285 LFTSKKRFAMLDTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCY 349

  Fly   325 QELKELFPVAGDFEVTYDD---------LQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSG 380
            ||:          :...||         |.::..||..:.||:||.||||...|||.|:..||:|
  Fly   350 QEI----------QANIDDELNILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNG 404

  Fly   381 VVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGL 445
            :::|||..|.:.:|..|||.::|.: |..|.|:.|||:|.::||.|||||||.|:|||||.|:.:
  Fly   405 LILPKGSQIFVHVFDIHRNPEYWDS-PEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAM 468

  Fly   446 MSSKLALSKILRNCKV 461
            ...|..:..:|:..::
  Fly   469 QEMKTLMVALLKQFQI 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 113/406 (28%)
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 113/406 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.