DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4ad1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:524 Identity:117/524 - (22%)
Similarity:218/524 - (41%) Gaps:81/524 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAVGVCFWIYFLWSRRRL--YMMHF-----KIPGPMGLPILGIAFEYLI---TYKRKMSIRTKY 61
            |:|:.:......::...|:  |:.|.     .||||...|.:|..|::.:   .|.:|:....:.
  Fly     3 LIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKVLQYCRK 67

  Fly    62 MDIYGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFS--KPVNSCTGDGLLSLEASKWV 124
            .|..|...||::  ...::..||...:.|..|...|.:..::|  :|   ..|||||:...::|:
  Fly    68 YDFQGFRSLVFL--QYHMMLSDPAEIQNILSSSSLLYKEHLYSFLRP---WLGDGLLTSSGARWL 127

  Fly   125 DRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEK-KVRDDIVRWSFRIATQTTVG-- 186
            ..:|...|||:::.:..:|.:.:......|..||.|....|. ..::.:.:.:..|..:...|  
  Fly   128 KHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTLDIVCENATGQD 192

  Fly   187 ------------------TDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHNKIFSTLGGFET 233
                              .||.::.:|   |::|.::...::                |....:.
  Fly   193 SSSLNGETSDLHGAIKDLCDVVQERTF---SIVKRFDALFRL----------------TSYYMKQ 238

  Fly   234 QKALA--KSNVNKMIGTIVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSRE-EVQSECCSFV 295
            ::||:  :|.:|::|.....:..........||.....::..:....:|::.:| |:..|..:|:
  Fly   239 RRALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKEREIIEEVSTFI 303

  Fly   296 VAAFETTGDTVYHALILLAMFPEHQDTVYQELKELF--PVAGDFEVTYDDLQRMVFLERVVNETL 358
            ....:.....:...|..|:...|.|....:|.:.:|  ..||:.::.  .|.:|.:||.::.|||
  Fly   304 FTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLA--RLDQMHYLELIIRETL 366

  Fly   359 RLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHF-LPDNVRD 422
            ||.||||...| |.|:....:|..:.|...:.:.:.|...|..:: .||.:|.|:.| .|.....
  Fly   367 RLYPSVPLIAR-TNRNPIDINGTKVAKCTTVIMCLIAMGYNEKYF-DDPCTFRPERFENPTGNVG 429

  Fly   423 RHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDNIGMELAQSPGLE 487
            ...:..:|||.|.|.||..|:.:...|..||::||        |:|.|..||.:      .||:.
  Fly   430 IEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLR--------RFEILPAVDGL------PPGIN 480

  Fly   488 FHRR 491
            .|.|
  Fly   481 DHSR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 102/461 (22%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 104/469 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.