DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a3 and Cyp4ae1

DIOPT Version :9

Sequence 1:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster


Alignment Length:441 Identity:104/441 - (23%)
Similarity:203/441 - (46%) Gaps:25/441 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IPGPMGLPILGIAFEYLITYKRKMSIR-TKYMDIYGSTCLVWVGPTPFVITRDPKIAEEIFLSPE 95
            :|....:|:||.|::........:..: .:|:..:|.:.:..|.....::|.:|:..:.:.....
  Fly    34 VPSVSRVPLLGAAWQMRSFQPDNLHDKFAEYVKRFGRSFMGTVLGHVVMVTAEPRHIDALLQGQH 98

  Fly    96 CLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSL 160
            .|.:.:::. .:....|||||.....:|...||.:.|.|..::|..|:.:|:.::..||..|.:|
  Fly    99 QLKKGTMYF-ALRGWLGDGLLLSRGKEWHTMRKIITPTFHFSILEQFVEVFDRQSSILVERLRTL 162

  Fly   161 -VGQGEKKVRDDIVRWSFRIATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLLP---FTH 221
             .|.....:...:...:..|.|:|.:|.:|  ||...:..|:.:.:....|:....:.|   |.|
  Fly   163 SYGNEVVNIYPLVGLAALDIITETAMGVNV--DAQGADSEVVHAVKDLTNILATRFMRPHLLFPH 225

  Fly   222 NKIFSTLGGFETQKALAKSNVNKMIGTIVDKKLMTKPESGSQPEIT---SVINKAIELHRNGE-M 282
            ........||..|:| ....:::....|::::........:|.:.|   ::::..:....:|: :
  Fly   226 LFRLCWPSGFRKQQA-GVICLHEFTNGIIEQRRRLLAREANQDKPTKPHALLDTLLRATVDGQPL 289

  Fly   283 SREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELK-----ELFPVAGDFEVTYD 342
            :.::::.|..:|:....:||...|...|.||:.....|..:::||:     :||.     .|...
  Fly   290 TDKQIRDEVNTFIFEGHDTTTSAVSFCLYLLSRHEAVQQKLFEELRMHYGQDLFR-----GVILS 349

  Fly   343 DLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDP 407
            |...:.:|..||.|:|||.|.:|...|...:|..:..| .||.|..:.:.::...|:...: |||
  Fly   350 DFATLPYLSCVVKESLRLYPPIPAVARCLEKDLVIDEG-YIPVGTNVVVLLWQLLRDEAIF-TDP 412

  Fly   408 SSFNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRN 458
            ..|.|:..|.:......||:|||||.|.|||||.|:.|:..|..::|::|:
  Fly   413 LVFQPERHLGEEAPRLSPYSYIPFSAGPRNCIGQKFALLEMKTMVTKVIRH 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 104/440 (24%)
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 104/440 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.